DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cbp53E and calb2b

DIOPT Version :9

Sequence 1:NP_001286511.1 Gene:Cbp53E / 36905 FlyBaseID:FBgn0004580 Length:310 Species:Drosophila melanogaster
Sequence 2:NP_957005.1 Gene:calb2b / 393684 ZFINID:ZDB-GENE-040426-1668 Length:269 Species:Danio rerio


Alignment Length:274 Identity:129/274 - (47%)
Similarity:177/274 - (64%) Gaps:18/274 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 DPESRELKKLSANQFMDVWAHYDKDGNGYIEGTELDGFLREFVSSANATDISPEAVTDTMLEELK 90
            :|.|..|.:|:|:||:|:|..:|.||||.|||.||:.|:||...:....|.|..:..|.|.|   
Zfish     7 EPISLHLAELTASQFLDIWNKFDADGNGCIEGKELENFIRELEIARKTADPSNASFKDRMKE--- 68

  Fly    91 SCFMEAYDDNQDGKIDIRELAQLLPMEENFLLLFRFDNPLESSVEFMKIWREYDTDNSGYIEADE 155
              ||:.:|:|.||||::.||||:||.||||||.||  ..:.||.|||..||:||||.|||||::|
Zfish    69 --FMQKFDENGDGKIEMSELAQILPTEENFLLCFR--QFVGSSAEFMTAWRKYDTDRSGYIESNE 129

  Fly   156 LKNFLRDLLKEAKKINDVSEDKLIEYTDTMLQVFDANKDGRLQLSEMAKLLPVKENFLCR-QVFK 219
            ||.||.||||:|.:  ..::.||.|||.|:|::||.|.||:|.|||||:||||:||||.: |.| 
Zfish   130 LKGFLSDLLKKANR--HYNDKKLNEYTQTILKMFDLNGDGKLGLSEMARLLPVEENFLLKFQNF- 191

  Fly   220 GATKLTKEDIEKVFSLYDRDNSGTIENEELKGFLKDLLELVKKDDYDAQDLAAFEETIMRGVGTD 284
               ||:.|:.|.:|:.||:|.:|.|:..||...|:||.. ..|...|...|::.:::||   ...
Zfish   192 ---KLSAEEFEAIFNYYDKDGNGYIDEHELDALLRDLYH-KHKMAVDPHSLSSSKKSIM---ALS 249

  Fly   285 KHGKISRKELTMIL 298
            ..||:.|.||.::|
Zfish   250 DGGKLFRTELEIVL 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cbp53ENP_001286511.1 EFh_HEF_CBN 40..301 CDD:320079 123/260 (47%)
EF-hand motif 40..68 CDD:320079 16/27 (59%)
EF-hand motif 89..118 CDD:320079 14/28 (50%)
EF-hand motif 135..164 CDD:320079 20/28 (71%)
EF-hand motif 181..210 CDD:320079 19/28 (68%)
EF-hand motif 228..257 CDD:320079 11/28 (39%)
EF-hand motif 273..301 CDD:320079 8/26 (31%)
calb2bNP_957005.1 PTZ00184 13..178 CDD:185504 91/173 (53%)
EFh 20..90 CDD:238008 34/74 (46%)
EFh 109..178 CDD:238008 42/70 (60%)
EF-hand_7 155..218 CDD:290234 33/66 (50%)
EFh 157..223 CDD:238008 34/69 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170574424
Domainoid 1 1.000 90 1.000 Domainoid score I7756
eggNOG 1 0.900 - - E33208_3BHMG
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48379
OrthoDB 1 1.010 - - D415503at33208
OrthoFinder 1 1.000 - - FOG0003230
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104970
Panther 1 1.100 - - O PTHR19972
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2186
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1110.720

Return to query results.
Submit another query.