DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cbp53E and TpnC47D

DIOPT Version :9

Sequence 1:NP_001286511.1 Gene:Cbp53E / 36905 FlyBaseID:FBgn0004580 Length:310 Species:Drosophila melanogaster
Sequence 2:NP_001286310.1 Gene:TpnC47D / 36195 FlyBaseID:FBgn0010423 Length:155 Species:Drosophila melanogaster


Alignment Length:146 Identity:34/146 - (23%)
Similarity:63/146 - (43%) Gaps:39/146 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 ISPEAVTDTM-----------LEELKSCFMEAYDDNQDGKIDIRELAQLLP---MEENFLLLFRF 126
            |..|.|.|.:           |:||    ::..|:::.|:::..|..||..   :||:       
  Fly    31 IPTEMVADILRLMGQPFDRQILDEL----IDEVDEDKSGRLEFEEFVQLAAKFIVEED------- 84

  Fly   127 DNPLESSVEFMKIWREYDTDNSGYIEADELKNFLRDLLKEAKKINDVSEDKLIEY-TDTMLQVFD 190
            |..::.  |..:.:|.||...:|||....||..|::|           :|:|.|. .|.|::..|
  Fly    85 DEAMQK--ELREAFRLYDKQGNGYIPTSCLKEILKEL-----------DDQLTEQELDIMIEEID 136

  Fly   191 ANKDGRLQLSEMAKLL 206
            ::..|.:...|..:::
  Fly   137 SDGSGTVDFDEFMEMM 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cbp53ENP_001286511.1 EFh_HEF_CBN 40..301 CDD:320079 34/146 (23%)
EF-hand motif 40..68 CDD:320079
EF-hand motif 89..118 CDD:320079 6/31 (19%)
EF-hand motif 135..164 CDD:320079 10/28 (36%)
EF-hand motif 181..210 CDD:320079 5/27 (19%)
EF-hand motif 228..257 CDD:320079
EF-hand motif 273..301 CDD:320079
TpnC47DNP_001286310.1 FRQ1 8..155 CDD:227455 34/146 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5029
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.