DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cbp53E and azot

DIOPT Version :9

Sequence 1:NP_001286511.1 Gene:Cbp53E / 36905 FlyBaseID:FBgn0004580 Length:310 Species:Drosophila melanogaster
Sequence 2:NP_610336.1 Gene:azot / 35751 FlyBaseID:FBgn0033238 Length:148 Species:Drosophila melanogaster


Alignment Length:170 Identity:43/170 - (25%)
Similarity:70/170 - (41%) Gaps:35/170 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 MDVWAHYDKDGNGYIEGTELDGFLREFVSSANATDISPEAVTDTMLEELKSCFMEAYDDNQDGKI 105
            :|.:...|||..|.|...|:...:|......|      :|...:|:.|:        |...:|.|
  Fly    13 LDTFRILDKDNEGAITSKEMAVVIRALGRQPN------DAEVQSMINEV--------DSEGNGSI 63

  Fly   106 DIRELAQLLPMEENFLLLFRFDNPLESSVEFMKIWREYDTDNSGYIEADELKNFLRDL-LKEAKK 169
            ...|..       |.:|....|...|.  |..:.:|.:|.||:|||...||||....| :|    
  Fly    64 VAPEFC-------NVILRKMRDTNHED--ELREAFRIFDKDNNGYITTTELKNVFTALGVK---- 115

  Fly   170 INDVSEDKLIEYTDTMLQVFDANKDGRLQLSEMAKLLPVK 209
               :|:|:|.|    |::.:|.::|..|...|...::.::
  Fly   116 ---LSDDELEE----MIREYDLDQDNHLNYEEFVNMMTMR 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cbp53ENP_001286511.1 EFh_HEF_CBN 40..301 CDD:320079 43/170 (25%)
EF-hand motif 40..68 CDD:320079 8/26 (31%)
EF-hand motif 89..118 CDD:320079 4/28 (14%)
EF-hand motif 135..164 CDD:320079 13/29 (45%)
EF-hand motif 181..210 CDD:320079 5/29 (17%)
EF-hand motif 228..257 CDD:320079
EF-hand motif 273..301 CDD:320079
azotNP_610336.1 PTZ00184 1..148 CDD:185504 43/168 (26%)
EFh 12..72 CDD:238008 17/79 (22%)
EFh 84..146 CDD:238008 23/72 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.