DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cbp53E and Scgn

DIOPT Version :9

Sequence 1:NP_001286511.1 Gene:Cbp53E / 36905 FlyBaseID:FBgn0004580 Length:310 Species:Drosophila melanogaster
Sequence 2:NP_663374.1 Gene:Scgn / 214189 MGIID:2384873 Length:276 Species:Mus musculus


Alignment Length:281 Identity:118/281 - (41%)
Similarity:177/281 - (62%) Gaps:23/281 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 KLSANQFMDVWAHYDKDGNGYIEGTELDGFLREFVSSANATDISPEAVTDTMLEE----LKSCFM 94
            :|.|..|..:|..:||:..|||..||||.|....::.:        ...||::||    :|...|
Mouse    11 RLDAACFWQIWQRFDKEEKGYIRETELDAFFDHLLAKS--------GTEDTLMEENVQKVKEQLM 67

  Fly    95 EAYDDNQDGKIDIRELAQL-LPMEENFLLLFRFDNPLESSVEFMKIWREYDTDNSGYIEADELKN 158
            .:::.:::|:|.::|||.: |..:|||||.||.:.||::|||||:|||:||.|:||:|.|.||.|
Mouse    68 TSHNVSKEGRILMKELASMFLSEDENFLLFFRLETPLDNSVEFMQIWRKYDADSSGFISAAELCN 132

  Fly   159 FLRDLLKEAKKINDVSEDKLIEYTDTMLQVFDANKDGRLQLSEMAKLLPVKENFLCRQVFK---G 220
            |||||....||  ::||.:|.|||.||:::||.||||||.|:::|::|.::||||.:  ||   .
Mouse   133 FLRDLFLHHKK--NISEAELEEYTSTMMKIFDKNKDGRLDLNDLARILALQENFLLQ--FKMDAS 193

  Fly   221 ATKLTKEDIEKVFSLYDRDNSGTIENEELKGFLKDLLELVKKDDYDAQDLAAFEETIMRGVGTDK 285
            :|:..|.|.||:|:.||...:|.:|..|:.||:||::||| :......||..|.|.::|....:|
Mouse   194 STEERKRDFEKIFAHYDVSKTGALEGPEVDGFVKDMMELV-QPSISGVDLDKFREILLRHCDVNK 257

  Fly   286 HGKISRKELTMILLTLAKISP 306
            .|||.:.||.:.|  ..||:|
Mouse   258 DGKIQKSELALCL--GLKINP 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cbp53ENP_001286511.1 EFh_HEF_CBN 40..301 CDD:320079 113/268 (42%)
EF-hand motif 40..68 CDD:320079 12/27 (44%)
EF-hand motif 89..118 CDD:320079 8/29 (28%)
EF-hand motif 135..164 CDD:320079 20/28 (71%)
EF-hand motif 181..210 CDD:320079 15/28 (54%)
EF-hand motif 228..257 CDD:320079 13/28 (46%)
EF-hand motif 273..301 CDD:320079 10/27 (37%)
ScgnNP_663374.1 EFh 109..179 CDD:238008 41/71 (58%)
EF-hand_7 111..178 CDD:290234 39/68 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167831420
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5088
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48379
OrthoDB 1 1.010 - - D415503at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104970
Panther 1 1.100 - - O PTHR19972
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.820

Return to query results.
Submit another query.