DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cbp53E and Pvalb

DIOPT Version :9

Sequence 1:NP_001286511.1 Gene:Cbp53E / 36905 FlyBaseID:FBgn0004580 Length:310 Species:Drosophila melanogaster
Sequence 2:NP_001317615.1 Gene:Pvalb / 19293 MGIID:97821 Length:110 Species:Mus musculus


Alignment Length:92 Identity:29/92 - (31%)
Similarity:50/92 - (54%) Gaps:10/92 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   210 ENFLCRQVFK--GATKLTKEDIEKVFSLYDRDNSGTIENEELKGFLKDLLELVKKDDYDAQDLAA 272
            ::|..::.|:  |..|...::::|||.:.|:|.||.||.:||...||..       ..||:||:|
Mouse    23 DSFDHKKFFQMVGLKKKNPDEVKKVFHILDKDKSGFIEEDELGSILKGF-------SSDARDLSA 80

  Fly   273 FE-ETIMRGVGTDKHGKISRKELTMIL 298
            .| :|::.....|..|||..:|.:.::
Mouse    81 KETKTLLAAGDKDGDGKIGVEEFSTLV 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cbp53ENP_001286511.1 EFh_HEF_CBN 40..301 CDD:320079 29/92 (32%)
EF-hand motif 40..68 CDD:320079
EF-hand motif 89..118 CDD:320079
EF-hand motif 135..164 CDD:320079
EF-hand motif 181..210 CDD:320079 29/92 (32%)
EF-hand motif 228..257 CDD:320079 13/28 (46%)
EF-hand motif 273..301 CDD:320079 7/27 (26%)
PvalbNP_001317615.1 EFh_parvalbumin_alpha 9..109 CDD:319997 29/92 (32%)
EF-hand motif 9..38 CDD:319997 3/14 (21%)
EF-hand motif 43..72 CDD:319997 13/35 (37%)
EF-hand motif 82..109 CDD:319997 7/26 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.