Sequence 1: | NP_001286511.1 | Gene: | Cbp53E / 36905 | FlyBaseID: | FBgn0004580 | Length: | 310 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001256428.1 | Gene: | cal-1 / 179715 | WormBaseID: | WBGene00000285 | Length: | 180 | Species: | Caenorhabditis elegans |
Alignment Length: | 203 | Identity: | 46/203 - (22%) |
---|---|---|---|
Similarity: | 86/203 - (42%) | Gaps: | 41/203 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 6 AAAAKRVQIEKAHNFMRQYRDPESRELKKLSANQFMDVWAHYDKDGNGYIEGTELDGFLREFVSS 70
Fly 71 ANATDISPEAVTDTMLEELKSCFMEAYDDNQDGKIDIRELAQLLP--MEENFLLLFRFDNPLESS 133
Fly 134 VEFMKIWREYDTDNSGYIEADELKNFLRDLLKEAKKINDVSEDKLIEYTDTMLQVFDANKDGRLQ 198
Fly 199 LSEMAKLL 206 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Cbp53E | NP_001286511.1 | EFh_HEF_CBN | 40..301 | CDD:320079 | 38/169 (22%) |
EF-hand motif | 40..68 | CDD:320079 | 11/27 (41%) | ||
EF-hand motif | 89..118 | CDD:320079 | 5/30 (17%) | ||
EF-hand motif | 135..164 | CDD:320079 | 8/28 (29%) | ||
EF-hand motif | 181..210 | CDD:320079 | 7/26 (27%) | ||
EF-hand motif | 228..257 | CDD:320079 | |||
EF-hand motif | 273..301 | CDD:320079 | |||
cal-1 | NP_001256428.1 | EFh_PEF | 36..177 | CDD:330173 | 39/176 (22%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |