DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cbp53E and Calb2

DIOPT Version :9

Sequence 1:NP_001286511.1 Gene:Cbp53E / 36905 FlyBaseID:FBgn0004580 Length:310 Species:Drosophila melanogaster
Sequence 2:NP_446440.1 Gene:Calb2 / 117059 RGDID:620981 Length:271 Species:Rattus norvegicus


Alignment Length:274 Identity:132/274 - (48%)
Similarity:184/274 - (67%) Gaps:14/274 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 RDPESRELKKLSANQFMDVWAHYDKDGNGYIEGTELDGFLREFVSSANATDISPEAVTDTMLEEL 89
            :.|....|.:|:|:||:::|.|:|.||||||||.||:.|.:|...:...:.:..:  :|...|::
  Rat     6 QQPPYLHLAELTASQFLEIWKHFDADGNGYIEGKELENFFQELEKARKGSGMMSK--SDNFGEKM 68

  Fly    90 KSCFMEAYDDNQDGKIDIRELAQLLPMEENFLLLFRFDNPLESSVEFMKIWREYDTDNSGYIEAD 154
            |. ||:.||.|.||||::.||||:||.||||||.||  ..:.||.|||:.||:||||.||||||:
  Rat    69 KE-FMQKYDKNSDGKIEMAELAQILPTEENFLLCFR--QHVGSSAEFMEAWRKYDTDRSGYIEAN 130

  Fly   155 ELKNFLRDLLKEAKKINDVSEDKLIEYTDTMLQVFDANKDGRLQLSEMAKLLPVKENFLCRQVFK 219
            |||.||.||||:|.:..|  |.||.|||.|:|::||.|.||:|.||||::||||:||||.:  |:
  Rat   131 ELKGFLSDLLKKANRPYD--EPKLQEYTQTILRMFDLNGDGKLGLSEMSRLLPVQENFLLK--FQ 191

  Fly   220 GATKLTKEDIEKVFSLYDRDNSGTIENEELKGFLKDLLELVKKDDYDAQDLAAFEETIMRGVGTD 284
            | .|||.|:...:|:.||:|.||.|:..||...||||.|..|| :.:.|.|..:.:::|   ...
  Rat   192 G-MKLTSEEFNAIFTFYDKDGSGYIDENELDALLKDLYEKNKK-EMNIQQLTTYRKSVM---SLA 251

  Fly   285 KHGKISRKELTMIL 298
            :.||:.||:|.::|
  Rat   252 EAGKLYRKDLEIVL 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cbp53ENP_001286511.1 EFh_HEF_CBN 40..301 CDD:320079 127/259 (49%)
EF-hand motif 40..68 CDD:320079 16/27 (59%)
EF-hand motif 89..118 CDD:320079 16/28 (57%)
EF-hand motif 135..164 CDD:320079 21/28 (75%)
EF-hand motif 181..210 CDD:320079 18/28 (64%)
EF-hand motif 228..257 CDD:320079 12/28 (43%)
EF-hand motif 273..301 CDD:320079 7/26 (27%)
Calb2NP_446440.1 EFh_HEF_CR 21..268 CDD:320077 127/259 (49%)
EF-hand motif 21..49 CDD:320077 16/27 (59%)
EF-hand motif 67..96 CDD:320077 16/29 (55%)
EF-hand motif 111..140 CDD:320077 21/28 (75%)
EF-hand motif 155..184 CDD:320077 18/28 (64%)
EF-hand motif 199..228 CDD:320077 12/28 (43%)
EF-hand motif 243..268 CDD:320077 7/26 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166335155
Domainoid 1 1.000 70 1.000 Domainoid score I9315
eggNOG 1 0.900 - - E33208_3BHMG
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 238 1.000 Inparanoid score I3288
OMA 1 1.010 - - QHG48379
OrthoDB 1 1.010 - - D415503at33208
OrthoFinder 1 1.000 - - FOG0003230
OrthoInspector 1 1.000 - - otm45973
orthoMCL 1 0.900 - - OOG6_104970
Panther 1 1.100 - - O PTHR19972
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2186
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.770

Return to query results.
Submit another query.