DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cbp53E and calb2

DIOPT Version :9

Sequence 1:NP_001286511.1 Gene:Cbp53E / 36905 FlyBaseID:FBgn0004580 Length:310 Species:Drosophila melanogaster
Sequence 2:XP_031756696.1 Gene:calb2 / 100496513 XenbaseID:XB-GENE-960001 Length:272 Species:Xenopus tropicalis


Alignment Length:274 Identity:136/274 - (49%)
Similarity:181/274 - (66%) Gaps:14/274 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 RDPESRELKKLSANQFMDVWAHYDKDGNGYIEGTELDGFLREFVSSANATDISPEAVTDTMLEEL 89
            :.|....|.:|:|:||:|:|.|||.||||||||.||:.|.||..::.....:  :|......|:|
 Frog     5 QQPLYLHLAELTASQFLDIWKHYDSDGNGYIEGKELENFFRELEAARRGAGV--DASNVNFGEKL 67

  Fly    90 KSCFMEAYDDNQDGKIDIRELAQLLPMEENFLLLFRFDNPLESSVEFMKIWREYDTDNSGYIEAD 154
            |. ||:.||.|.||:|::.||||:||.||||||.||  ....||:|||:.||:||||.||||||:
 Frog    68 KE-FMQKYDKNADGRIEMAELAQILPTEENFLLCFR--QHAGSSIEFMEAWRKYDTDRSGYIEAN 129

  Fly   155 ELKNFLRDLLKEAKKINDVSEDKLIEYTDTMLQVFDANKDGRLQLSEMAKLLPVKENFLCRQVFK 219
            |||.||.||||:|.:..|  |.||.|||.|:|::||.|.||:|.||||::||||:||||.:  |:
 Frog   130 ELKGFLSDLLKKANRPFD--EKKLHEYTQTILRMFDLNGDGKLCLSEMSRLLPVQENFLLK--FQ 190

  Fly   220 GATKLTKEDIEKVFSLYDRDNSGTIENEELKGFLKDLLELVKKDDYDAQDLAAFEETIMRGVGTD 284
            | .||:.::...:||.||:|.||.|:..||...|||..|..|| |.|.|.|..:.::||   ...
 Frog   191 G-MKLSSDEFNSIFSFYDKDGSGYIDENELDALLKDFFEKNKK-DVDIQSLTGYRQSIM---SLC 250

  Fly   285 KHGKISRKELTMIL 298
            ..|::.||||.::|
 Frog   251 DGGRLYRKELEIVL 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cbp53ENP_001286511.1 EFh_HEF_CBN 40..301 CDD:320079 131/259 (51%)
EF-hand motif 40..68 CDD:320079 19/27 (70%)
EF-hand motif 89..118 CDD:320079 16/28 (57%)
EF-hand motif 135..164 CDD:320079 21/28 (75%)
EF-hand motif 181..210 CDD:320079 18/28 (64%)
EF-hand motif 228..257 CDD:320079 13/28 (46%)
EF-hand motif 273..301 CDD:320079 8/26 (31%)
calb2XP_031756696.1 EFh_HEF_CR 20..267 CDD:320077 131/259 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 73 1.000 Domainoid score I9106
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 241 1.000 Inparanoid score I3250
OMA 1 1.010 - - QHG48379
OrthoDB 1 1.010 - - D415503at33208
OrthoFinder 1 1.000 - - FOG0003230
OrthoInspector 1 1.000 - - otm49057
Panther 1 1.100 - - O PTHR19972
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2186
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.080

Return to query results.
Submit another query.