DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9010 and GAPCP-1

DIOPT Version :9

Sequence 1:NP_611172.1 Gene:CG9010 / 36904 FlyBaseID:FBgn0034173 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_178071.1 Gene:GAPCP-1 / 844291 AraportID:AT1G79530 Length:422 Species:Arabidopsis thaliana


Alignment Length:330 Identity:211/330 - (63%)
Similarity:250/330 - (75%) Gaps:1/330 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IGINGFGRIGRMFARQALVRKDVKIVAINDPSLDPKYLAYMLRYDSTHGQFNQKISV-DGNNLVV 67
            :||||||||||:..|.|..|.|:::||:|||.:|.||:||||:||||||.|...|:| |.:.|.:
plant    89 VGINGFGRIGRLVLRIATSRDDIEVVAVNDPFIDAKYMAYMLKYDSTHGNFKGSINVIDDSTLEI 153

  Fly    68 NGKKIQLLKESDVKKIKWCDLGVHTVVECSGRFTTLKACQGHLDSGAKKVVISAPSADAPMFVCG 132
            ||||:.::.:.|..:|.|.|||...|||.||.||||.....||..|||||:||||||||||||.|
plant   154 NGKKVNVVSKRDPSEIPWADLGADYVVESSGVFTTLSKAASHLKGGAKKVIISAPSADAPMFVVG 218

  Fly   133 VNLEAYKPGTAIISNASCTTNCLAPLAKVVHDNFEICEGLMTTVHAATATQKIIDGPSSKLWRDG 197
            ||...|:|...|:||||||||||||||||||:.|.|.|||||||||.|||||.:||||.|.||.|
plant   219 VNEHTYQPNMDIVSNASCTTNCLAPLAKVVHEEFGILEGLMTTVHATTATQKTVDGPSMKDWRGG 283

  Fly   198 RSGMTNIIPASTGAAKAVGKVIPDLNGKLTGMAFRVPVPNVSVVDLTCRLSKPAKMDDIKKCIKA 262
            |....||||:|||||||||||:|:|||||||||||||..|||||||||||.|.|..:|:|..||.
plant   284 RGASQNIIPSSTGAAKAVGKVLPELNGKLTGMAFRVPTSNVSVVDLTCRLEKGASYEDVKAAIKH 348

  Fly   263 ASKCEMKGILGYVEEEVVSTDFNGSRFASVFDAKACIALNDNFVKLISWYDNETGYSCRLLDLVL 327
            ||:..:||||||.:|:|||.||.|...:|:|||.|.|.|:.:||||:||||||.|||.|:|||:.
plant   349 ASEGPLKGILGYTDEDVVSNDFVGDSRSSIFDANAGIGLSKSFVKLVSWYDNEWGYSNRVLDLIE 413

  Fly   328 YAQLV 332
            :..||
plant   414 HMALV 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9010NP_611172.1 GapA 4..331 CDD:223135 209/327 (64%)
Gp_dh_N 4..150 CDD:278473 84/146 (58%)
Gp_dh_C 155..312 CDD:280894 107/156 (69%)
GAPCP-1NP_178071.1 PLN02272 1..422 CDD:177912 211/330 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0057
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53863
OrthoDB 1 1.010 - - D945145at2759
OrthoFinder 1 1.000 - - FOG0000254
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100218
Panther 1 1.100 - - O PTHR10836
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
98.790

Return to query results.
Submit another query.