DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9010 and GAPCP-2

DIOPT Version :9

Sequence 1:NP_611172.1 Gene:CG9010 / 36904 FlyBaseID:FBgn0034173 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_173080.1 Gene:GAPCP-2 / 838199 AraportID:AT1G16300 Length:420 Species:Arabidopsis thaliana


Alignment Length:330 Identity:207/330 - (62%)
Similarity:251/330 - (76%) Gaps:1/330 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IGINGFGRIGRMFARQALVRKDVKIVAINDPSLDPKYLAYMLRYDSTHGQFNQKISV-DGNNLVV 67
            :||||||||||:..|.|..|.|:::||:|||.:|.||:|||.:||||||.:...|:| |.:.|.:
plant    87 VGINGFGRIGRLVLRIATFRDDIEVVAVNDPFIDAKYMAYMFKYDSTHGNYKGTINVIDDSTLEI 151

  Fly    68 NGKKIQLLKESDVKKIKWCDLGVHTVVECSGRFTTLKACQGHLDSGAKKVVISAPSADAPMFVCG 132
            |||:::::.:.|..:|.|.|||...|||.||.|||:.....||..|||||:||||||||||||.|
plant   152 NGKQVKVVSKRDPAEIPWADLGAEYVVESSGVFTTVGQASSHLKGGAKKVIISAPSADAPMFVVG 216

  Fly   133 VNLEAYKPGTAIISNASCTTNCLAPLAKVVHDNFEICEGLMTTVHAATATQKIIDGPSSKLWRDG 197
            ||.:.|.|...|:||||||||||||||||||:.|.|.|||||||||.|||||.:||||.|.||.|
plant   217 VNEKTYLPNMDIVSNASCTTNCLAPLAKVVHEEFGILEGLMTTVHATTATQKTVDGPSMKDWRGG 281

  Fly   198 RSGMTNIIPASTGAAKAVGKVIPDLNGKLTGMAFRVPVPNVSVVDLTCRLSKPAKMDDIKKCIKA 262
            |....||||:|||||||||||:|:|||||||||||||.||||||||||||.|.|..:|:|..||.
plant   282 RGASQNIIPSSTGAAKAVGKVLPELNGKLTGMAFRVPTPNVSVVDLTCRLEKDASYEDVKAAIKF 346

  Fly   263 ASKCEMKGILGYVEEEVVSTDFNGSRFASVFDAKACIALNDNFVKLISWYDNETGYSCRLLDLVL 327
            ||:..::|||||.||:|||.||.|...:|:|||.|.|.|:.:|:||:||||||.|||.|:|||:.
plant   347 ASEGPLRGILGYTEEDVVSNDFLGDSRSSIFDANAGIGLSKSFMKLVSWYDNEWGYSNRVLDLIE 411

  Fly   328 YAQLV 332
            :..||
plant   412 HMALV 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9010NP_611172.1 GapA 4..331 CDD:223135 205/327 (63%)
Gp_dh_N 4..150 CDD:278473 80/146 (55%)
Gp_dh_C 155..312 CDD:280894 107/156 (69%)
GAPCP-2NP_173080.1 PLN02272 1..420 CDD:177912 207/330 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0057
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53863
OrthoDB 1 1.010 - - D945145at2759
OrthoFinder 1 1.000 - - FOG0000254
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100218
Panther 1 1.100 - - O PTHR10836
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
98.790

Return to query results.
Submit another query.