DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9010 and GAPC2

DIOPT Version :9

Sequence 1:NP_611172.1 Gene:CG9010 / 36904 FlyBaseID:FBgn0034173 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_172801.1 Gene:GAPC2 / 837904 AraportID:AT1G13440 Length:338 Species:Arabidopsis thaliana


Alignment Length:327 Identity:197/327 - (60%)
Similarity:240/327 - (73%) Gaps:2/327 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IGINGFGRIGRMFARQALVRKDVKIVAINDPSLDPKYLAYMLRYDSTHGQF-NQKISV-DGNNLV 66
            |||||||||||:.||..|.|.||::||:|||.:..:|:.||.:|||.|||: :.::.| |...|:
plant     8 IGINGFGRIGRLVARVVLQRDDVELVAVNDPFITTEYMTYMFKYDSVHGQWKHHELKVKDDKTLL 72

  Fly    67 VNGKKIQLLKESDVKKIKWCDLGVHTVVECSGRFTTLKACQGHLDSGAKKVVISAPSADAPMFVC 131
            ...|.:.:....:.:.|.|.:.|...|||.:|.||.......||..|||||||||||.||||||.
plant    73 FGEKPVTVFGIRNPEDIPWGEAGADFVVESTGVFTDKDKAAAHLKGGAKKVVISAPSKDAPMFVV 137

  Fly   132 GVNLEAYKPGTAIISNASCTTNCLAPLAKVVHDNFEICEGLMTTVHAATATQKIIDGPSSKLWRD 196
            |||...||....|:||||||||||||||||::|.|.|.||||||||:.|||||.:||||.|.||.
plant   138 GVNEHEYKSDLDIVSNASCTTNCLAPLAKVINDRFGIVEGLMTTVHSITATQKTVDGPSMKDWRG 202

  Fly   197 GRSGMTNIIPASTGAAKAVGKVIPDLNGKLTGMAFRVPVPNVSVVDLTCRLSKPAKMDDIKKCIK 261
            ||:...||||:|||||||||||:|.||||||||:||||..:|||||||.||.|.|..|:|||.||
plant   203 GRAASFNIIPSSTGAAKAVGKVLPSLNGKLTGMSFRVPTVDVSVVDLTVRLEKAATYDEIKKAIK 267

  Fly   262 AASKCEMKGILGYVEEEVVSTDFNGSRFASVFDAKACIALNDNFVKLISWYDNETGYSCRLLDLV 326
            ..|:.:|||||||.|::||||||.|...:|:|||||.|||:|.||||:||||||.|||.|::||:
plant   268 EESEGKMKGILGYTEDDVVSTDFVGDNRSSIFDAKAGIALSDKFVKLVSWYDNEWGYSSRVVDLI 332

  Fly   327 LY 328
            ::
plant   333 VH 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9010NP_611172.1 GapA 4..331 CDD:223135 197/327 (60%)
Gp_dh_N 4..150 CDD:278473 72/147 (49%)
Gp_dh_C 155..312 CDD:280894 108/156 (69%)
GAPC2NP_172801.1 PLN02358 1..338 CDD:165999 197/327 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0057
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53863
OrthoDB 1 1.010 - - D945145at2759
OrthoFinder 1 1.000 - - FOG0000254
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100218
Panther 1 1.100 - - O PTHR10836
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.790

Return to query results.
Submit another query.