DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9010 and Pnma8b

DIOPT Version :9

Sequence 1:NP_611172.1 Gene:CG9010 / 36904 FlyBaseID:FBgn0034173 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_001100951.1 Gene:Pnma8b / 308393 RGDID:1560435 Length:667 Species:Rattus norvegicus


Alignment Length:189 Identity:41/189 - (21%)
Similarity:64/189 - (33%) Gaps:58/189 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 VKIVAINDPSLDPKYLAYMLRYDS---THGQFNQKISVDGNNLVVNGKKIQLLKESDVKKIKWCD 87
            |.|||..||: ||.....||:..|   |.|..::|...|....|::    .:.|::...::|   
  Rat   357 VAIVAYTDPA-DPSAREEMLKIASVIETLGWGDKKDKKDVLPQVLS----VMAKDTSGPRVK--- 413

  Fly    88 LGVHTVVECSGRFTTLKACQGHLDSGAKKVVISAPSADAPMFVCGVNLEAYKPGTAIISNASCTT 152
                  ||.:||         .:|:    :|:.....|..:..|             ||..:...
  Rat   414 ------VEEAGR---------QVDA----MVLRKAEEDGNLLEC-------------ISTLAEAE 446

  Fly   153 NCLAPLAKVVHDNFEICEGLMTTVH--------AATATQKIIDG---PSSKLWRDGRSG 200
            ||  |..|  .....:..|.....|        |..|.|.:::.   ..:..|..|.||
  Rat   447 NC--PKGK--KSGLGLLRGWTAEGHQGGLLELVALLAAQDMVEAVREEEASRWGGGGSG 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9010NP_611172.1 GapA 4..331 CDD:223135 41/189 (22%)
Gp_dh_N 4..150 CDD:278473 28/126 (22%)
Gp_dh_C 155..312 CDD:280894 11/57 (19%)
Pnma8bNP_001100951.1 PNMA 1..>114 CDD:405563
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0057
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.