DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9010 and Pnma8b

DIOPT Version :10

Sequence 1:NP_611172.1 Gene:CG9010 / 36904 FlyBaseID:FBgn0034173 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_001100951.1 Gene:Pnma8b / 308393 RGDID:1560435 Length:667 Species:Rattus norvegicus


Alignment Length:189 Identity:41/189 - (21%)
Similarity:64/189 - (33%) Gaps:58/189 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 VKIVAINDPSLDPKYLAYMLRYDS---THGQFNQKISVDGNNLVVNGKKIQLLKESDVKKIKWCD 87
            |.|||..||: ||.....||:..|   |.|..::|...|....|::    .:.|::...::|   
  Rat   357 VAIVAYTDPA-DPSAREEMLKIASVIETLGWGDKKDKKDVLPQVLS----VMAKDTSGPRVK--- 413

  Fly    88 LGVHTVVECSGRFTTLKACQGHLDSGAKKVVISAPSADAPMFVCGVNLEAYKPGTAIISNASCTT 152
                  ||.:||         .:|:    :|:.....|..:..|             ||..:...
  Rat   414 ------VEEAGR---------QVDA----MVLRKAEEDGNLLEC-------------ISTLAEAE 446

  Fly   153 NCLAPLAKVVHDNFEICEGLMTTVH--------AATATQKIIDG---PSSKLWRDGRSG 200
            ||  |..|  .....:..|.....|        |..|.|.:::.   ..:..|..|.||
  Rat   447 NC--PKGK--KSGLGLLRGWTAEGHQGGLLELVALLAAQDMVEAVREEEASRWGGGGSG 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9010NP_611172.1 GapA 4..328 CDD:439827 41/189 (22%)
Pnma8bNP_001100951.1 PNMA 1..>114 CDD:464357
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.