DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vha16-4 and VMA11

DIOPT Version :9

Sequence 1:NP_611169.1 Gene:Vha16-4 / 36900 FlyBaseID:FBgn0262513 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_015090.1 Gene:VMA11 / 855842 SGDID:S000006155 Length:164 Species:Saccharomyces cerevisiae


Alignment Length:147 Identity:82/147 - (55%)
Similarity:110/147 - (74%) Gaps:2/147 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 PQCASFFCILGAVCAIVFSTLGAAYGTAKASVGISSMSIKHPQLIMKAIVPVVMAGIIAIYGLVI 72
            |..|.||...|...|:|.|.||||.||||:.:||:.:....|:||||:::||||:||:||||||:
Yeast    12 PLYAPFFGFAGCAAAMVLSCLGAAIGTAKSGIGIAGIGTFKPELIMKSLIPVVMSGILAIYGLVV 76

  Fly    73 AVLLAGSLS--SPYSAYKGFLNLSAGLAVGVSGMGAGIAIGVVGEAGVRASAQQPKLFVAIILIL 135
            |||:||:||  ..|:.:.||::||.||.||.:.:.:|.|||:||:.|||....||:|||.|:|||
Yeast    77 AVLIAGNLSPTEDYTLFNGFMHLSCGLCVGFACLSSGYAIGMVGDVGVRKYMHQPRLFVGIVLIL 141

  Fly   136 IFAEVLGLYGLIVAIYL 152
            ||:|||||||:|||:.|
Yeast   142 IFSEVLGLYGMIVALIL 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vha16-4NP_611169.1 ATP-synt_C 13..118 CDD:294318 55/106 (52%)
ATP-synt_C 93..152 CDD:278563 36/58 (62%)
VMA11NP_015090.1 ATP-synt_C 17..124 CDD:412393 55/106 (52%)
ATP-synt_Vo_c_ATP6C_rpt2 92..159 CDD:349416 39/67 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0636
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S170
OMA 1 1.010 - - QHG53914
OrthoFinder 1 1.000 - - FOG0001101
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100711
Panther 1 1.100 - - O PTHR10263
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X666
TreeFam 1 0.960 - -
98.730

Return to query results.
Submit another query.