DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vha16-4 and OLI1

DIOPT Version :9

Sequence 1:NP_611169.1 Gene:Vha16-4 / 36900 FlyBaseID:FBgn0262513 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_009319.1 Gene:OLI1 / 854584 SGDID:S000007274 Length:76 Species:Saccharomyces cerevisiae


Alignment Length:65 Identity:20/65 - (30%)
Similarity:35/65 - (53%) Gaps:7/65 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 LSAGLA-VGVSGMGAGIAIGVVGEAGVRASAQQPKL----FVAIILILIFAEVLGLYGLIVAIYL 152
            :.||:: :|:  :||||.|.:|..|.:...::.|.:    |...||....:|..||:.|:|:..|
Yeast    10 IGAGISTIGL--LGAGIGIAIVFAALINGVSRNPSIKDTVFPMAILGFALSEATGLFCLMVSFLL 72

  Fly   153  152
            Yeast    73  72

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vha16-4NP_611169.1 ATP-synt_C 13..118 CDD:294318 10/25 (40%)
ATP-synt_C 93..152 CDD:278563 19/63 (30%)
OLI1NP_009319.1 ATP-synt_Fo_c_ATP5G3 8..72 CDD:349422 19/63 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0636
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.