DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vha16-4 and AVA-P4

DIOPT Version :9

Sequence 1:NP_611169.1 Gene:Vha16-4 / 36900 FlyBaseID:FBgn0262513 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_001185404.1 Gene:AVA-P4 / 843898 AraportID:AT1G75630 Length:200 Species:Arabidopsis thaliana


Alignment Length:184 Identity:88/184 - (47%)
Similarity:119/184 - (64%) Gaps:37/184 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 QCASFFCILGAVCAIVFSTLGAAYGTAKASVGISSMSIKHPQLIMKAIVPVVMAGIIAIYGLVIA 73
            :.|.||..|||..|:|||.:||||||||:.||::||.:..|:|:||:||||||||::.||||:||
plant    10 ETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIA 74

  Fly    74 VLLAGSL---SSPYSAYKGFLNLSAGLAVGVSGMGAGIAIGVVGEAGVR---------------- 119
            |:::..:   :..|..:.|:.:||:|||.|::|:.||:|||:||:||||                
plant    75 VIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVRVVDCNPDSKIKIYSFT 139

  Fly   120 ------------------ASAQQPKLFVAIILILIFAEVLGLYGLIVAIYLFSK 155
                              |:||||||||.:||||||||.|.||||||.|.|.|:
plant   140 TSFLSNLSQKELFIDLLSANAQQPKLFVGMILILIFAEALALYGLIVGIILSSR 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vha16-4NP_611169.1 ATP-synt_C 13..118 CDD:294318 57/107 (53%)
ATP-synt_C 93..152 CDD:278563 43/92 (47%)
AVA-P4NP_001185404.1 V_ATP_synt_C 14..122 CDD:130170 57/107 (53%)
ATP-synt_C 95..191 CDD:278563 43/95 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 89 1.000 Domainoid score I2684
eggNOG 1 0.900 - - E1_COG0636
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 200 1.000 Inparanoid score I1314
OMA 1 1.010 - - QHG53914
OrthoDB 1 1.010 - - D1534092at2759
OrthoFinder 1 1.000 - - FOG0001101
OrthoInspector 1 1.000 - - mtm1110
orthoMCL 1 0.900 - - OOG6_100711
Panther 1 1.100 - - O PTHR10263
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X666
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.840

Return to query results.
Submit another query.