DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vha16-4 and AT2G16510

DIOPT Version :9

Sequence 1:NP_611169.1 Gene:Vha16-4 / 36900 FlyBaseID:FBgn0262513 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_179244.1 Gene:AT2G16510 / 816150 AraportID:AT2G16510 Length:164 Species:Arabidopsis thaliana


Alignment Length:150 Identity:88/150 - (58%)
Similarity:119/150 - (79%) Gaps:3/150 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 QCASFFCILGAVCAIVFSTLGAAYGTAKASVGISSMSIKHPQLIMKAIVPVVMAGIIAIYGLVIA 73
            :.|.||..|||..|:|||.:||||||||:.||::||.:..|:|:||:||||||||::.||||:||
plant     8 ETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIA 72

  Fly    74 VLLAGSL---SSPYSAYKGFLNLSAGLAVGVSGMGAGIAIGVVGEAGVRASAQQPKLFVAIILIL 135
            |:::..:   :..|..:.|:.:||:|||.|::|:.||:|||:||:|||||:||||||||.:||||
plant    73 VIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVRANAQQPKLFVGMILIL 137

  Fly   136 IFAEVLGLYGLIVAIYLFSK 155
            ||||.|.||||||.|.|.|:
plant   138 IFAEALALYGLIVGIILSSR 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vha16-4NP_611169.1 ATP-synt_C 13..118 CDD:294318 57/107 (53%)
ATP-synt_C 93..152 CDD:278563 43/58 (74%)
AT2G16510NP_179244.1 V_ATP_synt_C 12..120 CDD:130170 57/107 (53%)
ATP-synt_Vo_c_ATP6C_rpt2 88..155 CDD:349416 44/66 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 89 1.000 Domainoid score I2684
eggNOG 1 0.900 - - E1_COG0636
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 200 1.000 Inparanoid score I1314
OMA 1 1.010 - - QHG53914
OrthoDB 1 1.010 - - D1534092at2759
OrthoFinder 1 1.000 - - FOG0001101
OrthoInspector 1 1.000 - - mtm1110
orthoMCL 1 0.900 - - OOG6_100711
Panther 1 1.100 - - O PTHR10263
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X666
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.