DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vha16-4 and ATP6V0B

DIOPT Version :9

Sequence 1:NP_611169.1 Gene:Vha16-4 / 36900 FlyBaseID:FBgn0262513 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_001281262.1 Gene:ATP6V0B / 533 HGNCID:861 Length:261 Species:Homo sapiens


Alignment Length:145 Identity:50/145 - (34%)
Similarity:83/145 - (57%) Gaps:12/145 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LGAVCAIVFSTLGAAYGTAKASVGISSMSIKHPQLIMKAIVPVVMAGIIAIYGLVIAVLLAGSLS 81
            ||...||..|.:|||:|.......|....:|.|::..|.:|.::....:||||:::|:::: :::
Human    52 LGIGLAISLSVVGAAWGIYITGSSIIGGGVKAPRIKTKNLVSIIFCEAVAIYGIIMAIVIS-NMA 115

  Fly    82 SPYSA-----------YKGFLNLSAGLAVGVSGMGAGIAIGVVGEAGVRASAQQPKLFVAIILIL 135
            .|:||           :.|:....|||.||:|.:..|:.:|:||.....|.||.|.|||.|:::.
Human   116 EPFSATDPKAIGHRNYHAGYSMFGAGLTVGLSNLFCGVCVGIVGSGAALADAQNPSLFVKILIVE 180

  Fly   136 IFAEVLGLYGLIVAI 150
            ||...:||:|:||||
Human   181 IFGSAIGLFGVIVAI 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vha16-4NP_611169.1 ATP-synt_C 13..118 CDD:294318 33/111 (30%)
ATP-synt_C 93..152 CDD:278563 27/58 (47%)
ATP6V0BNP_001281262.1 PRK08344 48..199 CDD:236246 50/145 (34%)
ATP-synt_C 52..112 CDD:278563 19/59 (32%)
ATP-synt_C 136..196 CDD:278563 27/60 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0636
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.