powered by:
Protein Alignment Vha16-4 and ATP5MC1
DIOPT Version :9
Sequence 1: | NP_611169.1 |
Gene: | Vha16-4 / 36900 |
FlyBaseID: | FBgn0262513 |
Length: | 155 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001002027.1 |
Gene: | ATP5MC1 / 516 |
HGNCID: | 841 |
Length: | 136 |
Species: | Homo sapiens |
Alignment Length: | 68 |
Identity: | 27/68 - (39%) |
Similarity: | 39/68 - (57%) |
Gaps: | 8/68 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 93 LSAGLA-VGVSGMGAGIAIGVVGEAGVRASAQQP----KLFVAIILILIFAEVLGLYGLIVA-IY 151
:.||.| |||:|.||| ||.|..:.:...|:.| :||...||....:|.:||:.|:|| :.
Human 70 IGAGAATVGVAGSGAG--IGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLI 132
Fly 152 LFS 154
||:
Human 133 LFA 135
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0636 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.