DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vha16-4 and ATP5MC1

DIOPT Version :9

Sequence 1:NP_611169.1 Gene:Vha16-4 / 36900 FlyBaseID:FBgn0262513 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_001002027.1 Gene:ATP5MC1 / 516 HGNCID:841 Length:136 Species:Homo sapiens


Alignment Length:68 Identity:27/68 - (39%)
Similarity:39/68 - (57%) Gaps:8/68 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 LSAGLA-VGVSGMGAGIAIGVVGEAGVRASAQQP----KLFVAIILILIFAEVLGLYGLIVA-IY 151
            :.||.| |||:|.|||  ||.|..:.:...|:.|    :||...||....:|.:||:.|:|| :.
Human    70 IGAGAATVGVAGSGAG--IGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLI 132

  Fly   152 LFS 154
            ||:
Human   133 LFA 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vha16-4NP_611169.1 ATP-synt_C 13..118 CDD:294318 13/25 (52%)
ATP-synt_C 93..152 CDD:278563 25/64 (39%)
ATP5MC1NP_001002027.1 ATP9 62..136 CDD:164765 27/68 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0636
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.