DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vha16-4 and VhaPPA1-1

DIOPT Version :9

Sequence 1:NP_611169.1 Gene:Vha16-4 / 36900 FlyBaseID:FBgn0262513 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_001247111.1 Gene:VhaPPA1-1 / 45247 FlyBaseID:FBgn0028662 Length:212 Species:Drosophila melanogaster


Alignment Length:152 Identity:54/152 - (35%)
Similarity:82/152 - (53%) Gaps:13/152 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LGAVCAIVFSTLGAAYGTAKASVGISSMSIKHPQLIMKAIVPVVMAGIIAIYGLVIAVLLAGSLS 81
            ||...::..|.:|||.|.......|....:|.|::..|.::.|:....:|||||:.|::|:|.|.
  Fly    54 LGIGLSVSLSVVGAALGIHTTGTSIVGGGVKAPRIKTKNLISVIFCEAVAIYGLITAIVLSGQLE 118

  Fly    82 --SPYSA-----------YKGFLNLSAGLAVGVSGMGAGIAIGVVGEAGVRASAQQPKLFVAIIL 133
              |..:|           :.|:|...||||||:..:..|||:|:||.....:.|....|||.|::
  Fly   119 QFSMETALSQAAIQNTNWFSGYLIFGAGLAVGLVNLFCGIAVGIVGSGAALSDAANAALFVKILI 183

  Fly   134 ILIFAEVLGLYGLIVAIYLFSK 155
            :.||...:||:||||.||:.||
  Fly   184 VEIFGSAIGLFGLIVGIYMTSK 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vha16-4NP_611169.1 ATP-synt_C 13..118 CDD:294318 37/113 (33%)
ATP-synt_C 93..152 CDD:278563 26/58 (45%)
VhaPPA1-1NP_001247111.1 ATP-synt_Vo_c_ATP6F_rpt1 51..113 CDD:349417 18/58 (31%)
ATP-synt_Vo_c_ATP6F_rpt2 138..202 CDD:349418 28/63 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453374
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0636
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10263
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.