DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vha16-4 and atp5mc3

DIOPT Version :9

Sequence 1:NP_611169.1 Gene:Vha16-4 / 36900 FlyBaseID:FBgn0262513 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_001005087.1 Gene:atp5mc3 / 448663 XenbaseID:XB-GENE-853227 Length:142 Species:Xenopus tropicalis


Alignment Length:68 Identity:27/68 - (39%)
Similarity:39/68 - (57%) Gaps:8/68 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 LSAGLA-VGVSGMGAGIAIGVVGEAGVRASAQQP----KLFVAIILILIFAEVLGLYGLIVA-IY 151
            :.||.| |||:|.|||  ||.|..:.:...|:.|    :||...||....:|.:||:.|:|| :.
 Frog    76 IGAGAATVGVAGSGAG--IGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLI 138

  Fly   152 LFS 154
            ||:
 Frog   139 LFA 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vha16-4NP_611169.1 ATP-synt_C 13..118 CDD:294318 13/25 (52%)
ATP-synt_C 93..152 CDD:278563 25/64 (39%)
atp5mc3NP_001005087.1 ATP9 68..142 CDD:164765 27/68 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.