DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vha16-4 and vma3

DIOPT Version :9

Sequence 1:NP_611169.1 Gene:Vha16-4 / 36900 FlyBaseID:FBgn0262513 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_594799.1 Gene:vma3 / 2542471 PomBaseID:SPAC1B3.14 Length:161 Species:Schizosaccharomyces pombe


Alignment Length:145 Identity:94/145 - (64%)
Similarity:118/145 - (81%) Gaps:0/145 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 PQCASFFCILGAVCAIVFSTLGAAYGTAKASVGISSMSIKHPQLIMKAIVPVVMAGIIAIYGLVI 72
            |..|.||.::|...||||::.|||||||||.||||:|.:..|.||:|..:||||||||||||||:
pombe     7 PVYAPFFGVMGCTAAIVFASFGAAYGTAKAGVGISAMGVLRPDLIVKNTIPVVMAGIIAIYGLVV 71

  Fly    73 AVLLAGSLSSPYSAYKGFLNLSAGLAVGVSGMGAGIAIGVVGEAGVRASAQQPKLFVAIILILIF 137
            :||::|:|....|.|.||:.|.|||:||::|:.||.|||:||:||||.:||||:||||:||||||
pombe    72 SVLISGNLKQILSLYSGFIQLGAGLSVGLAGLAAGFAIGIVGDAGVRGTAQQPRLFVAMILILIF 136

  Fly   138 AEVLGLYGLIVAIYL 152
            ||||||||||||:.|
pombe   137 AEVLGLYGLIVALLL 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vha16-4NP_611169.1 ATP-synt_C 13..118 CDD:294318 62/104 (60%)
ATP-synt_C 93..152 CDD:278563 44/58 (76%)
vma3NP_594799.1 V_ATP_synt_C 12..117 CDD:130170 62/104 (60%)
PRK09621 13..151 CDD:236595 90/137 (66%)
ATP-synt_C 92..151 CDD:278563 44/58 (76%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0636
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53914
OrthoFinder 1 1.000 - - FOG0001101
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100711
Panther 1 1.100 - - O PTHR10263
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X666
TreeFam 1 0.960 - -
87.780

Return to query results.
Submit another query.