DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vha16-4 and atp6v0ca

DIOPT Version :9

Sequence 1:NP_611169.1 Gene:Vha16-4 / 36900 FlyBaseID:FBgn0262513 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_001098606.2 Gene:atp6v0ca / 192336 ZFINID:ZDB-GENE-020419-23 Length:154 Species:Danio rerio


Alignment Length:153 Identity:98/153 - (64%)
Similarity:125/153 - (81%) Gaps:0/153 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LSLDEPQCASFFCILGAVCAIVFSTLGAAYGTAKASVGISSMSIKHPQLIMKAIVPVVMAGIIAI 67
            :....||.:.||.::||..|:|||.|||||||||:..||::||:..|:||||:|:||||||||||
Zfish     1 MDTQNPQYSPFFAVMGASSAMVFSALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGIIAI 65

  Fly    68 YGLVIAVLLAGSLSSPYSAYKGFLNLSAGLAVGVSGMGAGIAIGVVGEAGVRASAQQPKLFVAII 132
            ||||:|||:|.::....|.||.||:|.|||:||:||:.||.|||:||:||||.:||||:|||.:|
Zfish    66 YGLVVAVLIANNIGDKISLYKSFLHLGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMI 130

  Fly   133 LILIFAEVLGLYGLIVAIYLFSK 155
            |||||||||||||||||:.|.:|
Zfish   131 LILIFAEVLGLYGLIVALILSTK 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vha16-4NP_611169.1 ATP-synt_C 13..118 CDD:294318 66/104 (63%)
ATP-synt_C 93..152 CDD:278563 44/58 (76%)
atp6v0caNP_001098606.2 V_ATP_synt_C 11..116 CDD:130170 66/104 (63%)
PRK14893 12..154 CDD:184887 95/142 (67%)
ATP-synt_C 90..151 CDD:278563 44/60 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0636
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53914
OrthoDB 1 1.010 - - D1534092at2759
OrthoFinder 1 1.000 - - FOG0001101
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100711
Panther 1 1.100 - - O PTHR10263
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X666
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
98.790

Return to query results.
Submit another query.