DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vha16-4 and vha-2

DIOPT Version :9

Sequence 1:NP_611169.1 Gene:Vha16-4 / 36900 FlyBaseID:FBgn0262513 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_499166.1 Gene:vha-2 / 187779 WormBaseID:WBGene00006911 Length:161 Species:Caenorhabditis elegans


Alignment Length:145 Identity:88/145 - (60%)
Similarity:117/145 - (80%) Gaps:3/145 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 ASFFCILGAVCAIVFSTLGAAYGTAKASVGISSMSIKHPQLIMKAIVPVVMAGIIAIYGLVIAVL 75
            |.||..:||..|.:|:.|||||||||::|||.||.:..|:||||:::||:|||||.|||||:|::
 Worm    14 APFFGYMGAASAQIFTVLGAAYGTAKSAVGICSMGVMRPELIMKSVIPVIMAGIIGIYGLVVAMV 78

  Fly    76 LAGSLSSPYSAY---KGFLNLSAGLAVGVSGMGAGIAIGVVGEAGVRASAQQPKLFVAIILILIF 137
            |.|.::|..:.|   |||.:|:|||..|:.|:|||.|||:||:||||.:||||:|||.:||||||
 Worm    79 LKGKVTSASAGYDLNKGFAHLAAGLTCGLCGLGAGYAIGIVGDAGVRGTAQQPRLFVGMILILIF 143

  Fly   138 AEVLGLYGLIVAIYL 152
            :|||||||:|||:.|
 Worm   144 SEVLGLYGMIVALIL 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vha16-4NP_611169.1 ATP-synt_C 13..118 CDD:294318 60/107 (56%)
ATP-synt_C 93..152 CDD:278563 41/58 (71%)
vha-2NP_499166.1 V_ATP_synt_C 16..124 CDD:130170 60/107 (56%)
ATP-synt_Vo_c_ATP6C_rpt2 92..158 CDD:349416 44/65 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157895
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0636
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S170
OMA 1 1.010 - - QHG53914
OrthoDB 1 1.010 - - D1534092at2759
OrthoFinder 1 1.000 - - FOG0001101
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100711
Panther 1 1.100 - - O PTHR10263
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X666
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.710

Return to query results.
Submit another query.