DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ARAF and Raf

DIOPT Version :9

Sequence 1:NP_001243125.1 Gene:ARAF / 369 HGNCID:646 Length:609 Species:Homo sapiens
Sequence 2:NP_001096867.3 Gene:Raf / 31221 FlyBaseID:FBgn0003079 Length:739 Species:Drosophila melanogaster


Alignment Length:646 Identity:285/646 - (44%)
Similarity:373/646 - (57%) Gaps:107/646 - (16%)


- Green bases have known domain annotations that are detailed below.


Human    11 GAEPSRAVGT--------VKVYLPNKQRTVVTVRDGMSVYDSLDKALKVRGLNQDCCVVYRLIKG 67
            |::|....||        ::.:|||:|||.|.|..|:.:.|:|.||||:|.|..|.|.|.....|
  Fly   125 GSQPGSQCGTLTRQPKILLRAHLPNQQRTSVEVISGVRLCDALMKALKLRQLTPDMCEVSTTHSG 189

Human    68 RKTVTAWDTAIAPLDGEELIVEVLEDVPL---TMHNFVRKTFFSLAFCDFCLKFLFHGFRCQTCG 129
            |. :..|.|.|..|..||:.|.:|:..|:   ..|..:|||||||.||:.|.:.||.||.|..|.
  Fly   190 RH-IIPWHTDIGTLHVEEIFVRLLDKFPIRTHIKHQIIRKTFFSLVFCEGCRRLLFTGFYCSQCN 253

Human   130 YKFHQHCSSKVPTVC-----------------------------VDMSTNRQQPSRFYHSVQDLS 165
            ::|||.|:::||.:|                             |..:.:.:..||...|    |
  Fly   254 FRFHQRCANRVPMLCQPFPMDSYYQLLLAENPDNGVGFPGRGTAVRFNMSSRSRSRRCSS----S 314

Human   166 GGSRQHEAPSNRPLNELLTPQGPSPRTQHCDPEHFPFPAPANAPLQRIRSTSTPNV---HMVSTT 227
            |.|...:.||:...|.   .||..||....|                 ||.|.|||   ::.|.|
  Fly   315 GSSSSSKPPSSSSGNH---RQGRPPRISQDD-----------------RSNSAPNVCINNIRSVT 359

Human   228 APMDSNLIQ---------LTGQSFSTDAAGSRGGSDGTPRGSPSPASVSSGRKSPHSKSPAEQRE 283
            :.:..:||.         .|..|.||.|               ||.|.....: |.::|..|..:
  Fly   360 SEVQRSLIMQARPPLPHPCTDHSNSTQA---------------SPTSTLKHNR-PRARSADESNK 408

Human   284 RKSLADDKKKVKNLGYRDSGYYWEVPPSEVQLLKRIGTGSFGTVFRGRWHGDVAVKVLKVSQPTA 348
            ...|.|.|...:|         |.:...|:.:..|||:||||||:|..|||.||||.|.|..|:.
  Fly   409 NLLLRDAKSSEEN---------WNILAEEILIGPRIGSGSFGTVYRAHWHGPVAVKTLNVKTPSP 464

Human   349 EQAQAFKNEMQVLRKTRHVNILLFMGFMTRPGFAIITQWCEGSSLYHHLHVADTRFDMVQLIDVA 413
            .|.||||||:.:|:||||.|||||||.:::|..||:||||||||||.|:||::|:|.:..|||:.
  Fly   465 AQLQAFKNEVAMLKKTRHCNILLFMGCVSKPSLAIVTQWCEGSSLYKHVHVSETKFKLNTLIDIG 529

Human   414 RQTAQGMDYLHAKNIIHRDLKSNNIFLHEGLTVKIGDFGLATVKTRWSGAQPLEQPSGSVLWMAA 478
            ||.||||||||||||||||||||||||||.|:||||||||||.||||||.:...||:||:||||.
  Fly   530 RQVAQGMDYLHAKNIIHRDLKSNNIFLHEDLSVKIGDFGLATAKTRWSGEKQANQPTGSILWMAP 594

Human   479 EVIRMQDPNPYSFQSDVYAYGVVLYELMTGSLPYSHIGCRDQIIFMVGRGYLSPDLSKISSNCPK 543
            ||||||:.|||||||||||:|:|:|||:...|||.||..:|||:||||||.|.||:|::.|:.|:
  Fly   595 EVIRMQELNPYSFQSDVYAFGIVMYELLAECLPYGHISNKDQILFMVGRGLLRPDMSQVRSDAPQ 659

Human   544 AMRRLLSDCLKFQREERPLFPQILATIELLQRSLPKIERSASEPSLHRTQA--DE---LPA 599
            |::||..||:|:..::||||..:|..:|.:.|:||||.||||||:|.::|.  ||   ||:
  Fly   660 ALKRLAEDCIKYTPKDRPLFRPLLNMLENMLRTLPKIHRSASEPNLTQSQLQNDEFLYLPS 720

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ARAFNP_001243125.1 Raf_RBD 20..91 CDD:176411 30/78 (38%)
C1_1 99..146 CDD:278556 24/75 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 163..210 11/46 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 243..293 12/49 (24%)
STKc_A-Raf 312..576 CDD:271052 168/263 (64%)
RafNP_001096867.3 RBD_RAF 142..212 CDD:340514 29/70 (41%)
C1_Raf 221..269 CDD:410361 23/47 (49%)
STKc_Raf 435..687 CDD:270964 165/251 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 378 1.000 Domainoid score I861
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 586 1.000 Inparanoid score I1004
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49873
OrthoDB 1 1.010 - - D129822at33208
OrthoFinder 1 1.000 - - FOG0001587
OrthoInspector 1 1.000 - - otm40979
orthoMCL 1 0.900 - - OOG6_100006
Panther 1 1.100 - - O PTHR44329
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2599
SonicParanoid 1 1.000 - - X994
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1212.010

Return to query results.
Submit another query.