| Sequence 1: | NP_611168.2 | Gene: | CG15614 / 36899 | FlyBaseID: | FBgn0034168 | Length: | 469 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_572183.1 | Gene: | Proc-R / 31408 | FlyBaseID: | FBgn0029723 | Length: | 545 | Species: | Drosophila melanogaster |
| Alignment Length: | 143 | Identity: | 44/143 - (30%) |
|---|---|---|---|
| Similarity: | 62/143 - (43%) | Gaps: | 25/143 - (17%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 37 VLFVLYGLAVPTLSAFGLCTNFINAVVFMRPKMTPSAFSYLAALSWMDC--ISCLLITMTALSRS 99
Fly 100 YFYSSPT------WITYDY-QWQTPLFG-ISTGGANLILACLSLDRFIYLSC-FKRNNGAPRFCR 155
Fly 156 RKVARCII-VVAI 167 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG15614 | NP_611168.2 | 7tmA_FMRFamide_R-like | 40..338 | CDD:410630 | 43/140 (31%) |
| TM helix 1 | 41..67 | CDD:410630 | 6/25 (24%) | ||
| TM helix 2 | 73..98 | CDD:410630 | 9/26 (35%) | ||
| TM helix 3 | 112..142 | CDD:410630 | 11/31 (35%) | ||
| TM helix 4 | 157..177 | CDD:410630 | 5/12 (42%) | ||
| TM helix 5 | 200..225 | CDD:410630 | |||
| TM helix 6 | 257..293 | CDD:410630 | |||
| TM helix 7 | 306..331 | CDD:410630 | |||
| Proc-R | NP_572183.1 | 7tmA_FMRFamide_R-like | 41..488 | CDD:410630 | 43/140 (31%) |
| TM helix 1 | 42..68 | CDD:410630 | 6/25 (24%) | ||
| TM helix 2 | 74..99 | CDD:410630 | 10/28 (36%) | ||
| TM helix 3 | 114..144 | CDD:410630 | 12/33 (36%) | ||
| TM helix 4 | 156..176 | CDD:410630 | 5/12 (42%) | ||
| TM helix 5 | 351..378 | CDD:410630 | |||
| TM helix 6 | 415..445 | CDD:410630 | |||
| TM helix 7 | 456..481 | CDD:410630 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||