DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15614 and frpr-1

DIOPT Version :10

Sequence 1:NP_611168.2 Gene:CG15614 / 36899 FlyBaseID:FBgn0034168 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_509368.3 Gene:frpr-1 / 182105 WormBaseID:WBGene00015323 Length:378 Species:Caenorhabditis elegans


Alignment Length:87 Identity:21/87 - (24%)
Similarity:40/87 - (45%) Gaps:14/87 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   909 EYVHLKGLIHRDL-----KPSNIFFSLDGRIKIGDFGLVTDSSDLQ---YDSENNMP--TMVPNR 963
            |..:|:|.:.|.:     |.:.:.||....::..:..|..|:..|:   .::|.|.|  :::|..
 Worm   125 ELRNLEGRLERSITRIRSKKNELLFSEIDYMQKREVDLHNDNQILRAKIAENERNNPSISLMPGG 189

  Fly   964 HTRQVGTQLYMSPEQLKGLPYD 985
            ...:   || |.|.|.:..|:|
 Worm   190 SNYE---QL-MPPPQTQSQPFD 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15614NP_611168.2 7tmA_FMRFamide_R-like 40..338 CDD:410630
TM helix 1 41..67 CDD:410630
TM helix 2 73..98 CDD:410630
TM helix 3 112..142 CDD:410630
TM helix 4 157..177 CDD:410630
TM helix 5 200..225 CDD:410630
TM helix 6 257..293 CDD:410630
TM helix 7 306..331 CDD:410630
frpr-1NP_509368.3 7tmA_FMRFamide_R-like 48..341 CDD:410630 21/87 (24%)
TM helix 1 49..75 CDD:410630
TM helix 2 81..106 CDD:410630
TM helix 3 123..153 CDD:410630 7/27 (26%)
TM helix 4 166..201 CDD:410630 9/38 (24%)
TM helix 5 235..260 CDD:410630
TM helix 6 271..301 CDD:410630
TM helix 7 309..334 CDD:410630
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.