DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inaC and TCB2

DIOPT Version :10

Sequence 1:NP_476863.1 Gene:inaC / 36897 FlyBaseID:FBgn0004784 Length:700 Species:Drosophila melanogaster
Sequence 2:NP_014312.1 Gene:TCB2 / 855637 SGDID:S000005031 Length:1178 Species:Saccharomyces cerevisiae


Alignment Length:231 Identity:56/231 - (24%)
Similarity:85/231 - (36%) Gaps:66/231 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 TFCDECGLLLHGVAHQGV--------------------------KCENCNLNVHHACQETVP--- 183
            ||.|.||......|...:                          |.::.|...:..|:..:|   
Yeast   873 TFFDSCGYAAITSAKNAIRTIKTGWSGDFMIKELEWSVTTFRVTKTKDANKAENFICEVNIPTIE 937

  Fly   184 --------PMCGADISEVRGKLLLYV--------EL-------KGNNLKVDIKEAANLIPMDTNG 225
                    |.....|.:...|||:.|        ||       ...:||:..|.|.|||.::.||
Yeast   938 LVRNCYYKPSVLNLIGKKSAKLLVQVSWFPVTATELPQSDLITNSGDLKITAKSAENLIGVNKNG 1002

  Fly   226 FSDPYIAVQMHPDRSGRTKKKTKTIQKNLNPVFNETFTFELQPQDRDKRLLIEVWDWDRTSRNDF 290
            :||||:...:: ::|.....||...:|.|||.:||:.|.|:..:..| .|.|.|.|::.|:.|..
Yeast  1003 YSDPYVEFFLN-EKSTSPFFKTAVQKKTLNPTWNESKTIEVSNRVND-YLTINVKDYESTNSNRS 1065

  Fly   291 MGSFSFSLEELQKEPVDGWYKFLSQVEGEHYNIPCV 326
            :|.....|..:..|            ....:|||.|
Yeast  1066 IGKAVVPLSTIDPE------------SDTTFNIPLV 1089

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
inaCNP_476863.1 C1_cPKC_nPKC_rpt1 71..123 CDD:410342
C1 137..190 CDD:412127 11/78 (14%)
C2_PKC_alpha_gamma 194..324 CDD:175992 41/144 (28%)
STKc_PKC 375..692 CDD:270722
TCB2NP_014312.1 COG5038 4..1178 CDD:227371 56/231 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.