DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inaC and AGC1.7

DIOPT Version :9

Sequence 1:NP_476863.1 Gene:inaC / 36897 FlyBaseID:FBgn0004784 Length:700 Species:Drosophila melanogaster
Sequence 2:NP_001185434.1 Gene:AGC1.7 / 844265 AraportID:AT1G79250 Length:555 Species:Arabidopsis thaliana


Alignment Length:604 Identity:151/604 - (25%)
Similarity:224/604 - (37%) Gaps:202/604 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   173 NVHHACQETVPPMCGADI--------SEVRGKLLLYVELKGNNLKVDIKEAANLIPMDTNGFSD- 228
            :.||......||:   ||        .|::.|.|.           |.|:..|||..:..||:: 
plant    14 STHHTTSSNYPPL---DIVHQTPQPRKEMQQKPLF-----------DPKKMDNLIKPEPAGFTNH 64

  Fly   229 ------PYIAVQMHPDRSGRTKKKTKTIQKNLNPVFNETFTFELQPQDRDKRLLIEVWDWDRTSR 287
                  |.|     |...|....::   |.|||...|.                      :.::.
plant    65 HRPNPSPKI-----PSSPGSNMTES---QSNLNTKPNN----------------------NNSNN 99

  Fly   288 NDFMGSFSFSLEELQKEP----VDG---WYKFLSQVEGEHYNIPCVDAFNDIARLRDEVRHDRRP 345
            |..|.|.|.|:|.....|    ..|   |                 ||.|.:.            
plant   100 NSNMSSRSNSIESTSSNPSKPHTGGDIRW-----------------DAVNTLT------------ 135

  Fly   346 NEKRRMDNKDMPHNMSKRDMIRAADFNFVKVIGKGSFGKVLLAERRGTDELYAVKVLRKDVIIQT 410
                           ||...:..:||..:|.:|.|..|.|.|.|.|||...:|:||:.|..:...
plant   136 ---------------SKGVQLGISDFRLLKRLGYGDIGSVYLVELRGTITYFAMKVMDKASLASR 185

  Fly   411 DDMELPMNEKKILALSGRPPFLVSMHSCFQTMDRLF-FVMEYCKGGDLMYHMQQYGR---FKESV 471
            :.:.....|::||:.... |||.:::|.|:| |:.: .|||:|.||:| |.::|...   |.|..
plant   186 NKLLRAQTEREILSQLDH-PFLPTLYSHFET-DKFYCLVMEFCGGGNL-YSLRQKQPNKCFTEDA 247

  Fly   472 AIFYAVEVAIALFFLHERDIIYRDLKLDNILLDGEGHVKLVDFGLS------------------- 517
            |.|:|.||.:||.:||...|:|||||.:|:|:..:||:.|.||.||                   
plant   248 ARFFASEVLLALEYLHMLGIVYRDLKPENVLVRDDGHIMLSDFDLSLRCSVSPTLVKSSSVHAAG 312

  Fly   518 -----------------KEGVTERQT--------------------------------------T 527
                             .:|..:..|                                      :
plant   313 GGSGSSRPVGLIDEDAAVQGCIQPSTFFPRILQSSKKNRKAKSDFGLFVNGSMPELMAEPTNVKS 377

  Fly   528 RTFCGTPNYMAPEIVSYDPYSIAADWWSFGVLLFEFMAGQAPFEGDDETTVFRNIKDKKAVFPK- 591
            .:|.||..|:||||:..:.:..|.|||:||:.::|.:.|..||:|........|:..:...||: 
plant   378 MSFVGTHEYLAPEIIRGEGHGSAVDWWTFGIFIYELLYGATPFKGQGNRATLHNVIGQALRFPEV 442

  Fly   592 -HFSVEAMDIITSFLTKKPNNRLGAGRYARQEITTHPFFRNVDWDKAEACEMEPPIKPMIKHRKD 655
             |.|..|.|:|...|.|:|..|:...|.| .||..||||..|:|  |......||      |..:
plant   443 PHVSSAARDLIKGLLVKEPQKRIAYKRGA-TEIKQHPFFEGVNW--ALIRSATPP------HVPE 498

  Fly   656 ISNFDDAFTKEKTDLTPTD 674
            ..:|....:|:|..:...|
plant   499 PVDFSCYASKDKESMAAVD 517

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
inaCNP_476863.1 C1_1 72..124 CDD:278556
C1_1 137..189 CDD:278556 4/15 (27%)
C2_PKC_alpha_gamma 194..324 CDD:175992 27/143 (19%)
S_TKc 371..629 CDD:214567 99/337 (29%)
STKc_PKC 375..692 CDD:270722 110/380 (29%)
AGC1.7NP_001185434.1 STKc_phototropin_like 144..501 CDD:270726 108/368 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 206 1.000 Inparanoid score I1276
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.