DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inaC and AT1G73580

DIOPT Version :10

Sequence 1:NP_476863.1 Gene:inaC / 36897 FlyBaseID:FBgn0004784 Length:700 Species:Drosophila melanogaster
Sequence 2:NP_177499.1 Gene:AT1G73580 / 843692 AraportID:AT1G73580 Length:168 Species:Arabidopsis thaliana


Alignment Length:101 Identity:33/101 - (32%)
Similarity:54/101 - (53%) Gaps:12/101 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   208 LKVDIKEAANLIPMDTNGFSDPYIAVQMHPDRSGRTKKKTKTIQKNLNPVFNETFTFELQPQDRD 272
            |:|.::...||...|.:. ||||:.:::     ||.|.|||.:::|:||.:.|..:|.:  .|.:
plant    11 LRVRVQRGVNLAVRDVSS-SDPYVVLKL-----GRQKLKTKVVKQNVNPQWQEDLSFTV--TDPN 67

  Fly   273 KRLLIEVWDWDRTSRNDFMGSFSFSL----EELQKE 304
            ..|.:.|:|.|..|::|.||.....|    |.|:.|
plant    68 LPLTLIVYDHDFFSKDDKMGDAEIDLKPYIEALRME 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
inaCNP_476863.1 C1_cPKC_nPKC_rpt1 71..123 CDD:410342
C1 137..190 CDD:412127
C2_PKC_alpha_gamma 194..324 CDD:175992 33/101 (33%)
STKc_PKC 375..692 CDD:270722
AT1G73580NP_177499.1 C2_ArfGAP 8..151 CDD:176003 33/101 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.