DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inaC and AT1G70810

DIOPT Version :10

Sequence 1:NP_476863.1 Gene:inaC / 36897 FlyBaseID:FBgn0004784 Length:700 Species:Drosophila melanogaster
Sequence 2:NP_565002.1 Gene:AT1G70810 / 843418 AraportID:AT1G70810 Length:165 Species:Arabidopsis thaliana


Alignment Length:109 Identity:34/109 - (31%)
Similarity:52/109 - (47%) Gaps:17/109 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   208 LKVDIKEAANLIPMDTNGFSDPYIAVQMHPDRSGRTKKKTKTIQKNLNPVFNETFTFELQPQDRD 272
            |::.:|...||...||.. |||::.:.|     |..|.||:.::.|.||.:||..|..|:..|..
plant     8 LRIRVKRGINLAQRDTLS-SDPFVVITM-----GSQKLKTRVVENNCNPEWNEELTLALRHPDEP 66

  Fly   273 KRLLIEVWDWDRTSRNDFMGSFSFSLEE--------LQKEPVDG 308
            ..|:  |:|.|..:.:|.||.....::.        ||:.| ||
plant    67 VNLI--VYDKDTFTSHDKMGDAKIDIKPFLEVHKMGLQELP-DG 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
inaCNP_476863.1 C1_cPKC_nPKC_rpt1 71..123 CDD:410342
C1 137..190 CDD:412127
C2_PKC_alpha_gamma 194..324 CDD:175992 34/109 (31%)
STKc_PKC 375..692 CDD:270722
AT1G70810NP_565002.1 C2_ArfGAP 5..148 CDD:176003 34/109 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.