DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inaC and WAG1

DIOPT Version :9

Sequence 1:NP_476863.1 Gene:inaC / 36897 FlyBaseID:FBgn0004784 Length:700 Species:Drosophila melanogaster
Sequence 2:NP_175774.1 Gene:WAG1 / 841807 AraportID:AT1G53700 Length:476 Species:Arabidopsis thaliana


Alignment Length:378 Identity:112/378 - (29%)
Similarity:164/378 - (43%) Gaps:92/378 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   349 RRMDNKDMPHNMSKRDMIRAA------------DFNFVKVIGKGSFGKVLLAERRGTDEL--YAV 399
            ||.|    ||..|    ||||            .|..|:.:|.|:.|:|.|...|.....  :|:
plant    67 RRYD----PHWTS----IRAATTLSSDGRLHLRHFKLVRHLGTGNLGRVFLCHLRDCPNPTGFAL 123

  Fly   400 KVLRKDVI-------IQTDDMELPMNEKKILALSGRPPFLVSMHSCFQTMDRLFFVMEYCKGGDL 457
            ||:.:||:       ::|        |.:||:|... |||.::::..........:::||..|||
plant   124 KVIDRDVLTAKKISHVET--------EAEILSLLDH-PFLPTLYARIDASHYTCLLIDYCPNGDL 179

  Fly   458 --MYHMQQYGRFKESVAIFYAVEVAIALFFLHERDIIYRDLKLDNILLDGEGHVKLVDFGL---- 516
              :...|...|...|...|:|.||.:||.:||...|:|||||.:|||:..:||:.|.||.|    
plant   180 HSLLRKQPNNRLPISPVRFFAAEVLVALEYLHALGIVYRDLKPENILIREDGHIMLSDFDLCFKA 244

  Fly   517 ----------------------------SKEGVTERQT-------------TRTFCGTPNYMAPE 540
                                        |.|...||:.             :::..||..|:|||
plant   245 DVVPTFRSRRFRRTSSSPRKTRRGGGCFSTEVEYEREEIVAEFAAEPVTAFSKSCVGTHEYLAPE 309

  Fly   541 IVSYDPYSIAADWWSFGVLLFEFMAGQAPFEGDDETTVFRNI---KDKKAVFPKHFSVEAMDIIT 602
            :|:.:.:....|||:||:.|:|.:.|..||:|..:....|||   .|......:...|||.|:|.
plant   310 LVAGNGHGSGVDWWAFGIFLYEMLYGTTPFKGGTKEQTLRNIVSNDDVAFTLEEEGMVEAKDLIE 374

  Fly   603 SFLTKKPNNRLGAGRYARQEITTHPFFRNVDWDKAEACEMEPP-IKPMIKHRK 654
            ..|.|.|..|||..|.| |:|..|.||..:.|....  ..:|| |:.::|..|
plant   375 KLLVKDPRKRLGCARGA-QDIKRHEFFEGIKWPLIR--NYKPPEIRGLVKKTK 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
inaCNP_476863.1 C1_1 72..124 CDD:278556
C1_1 137..189 CDD:278556
C2_PKC_alpha_gamma 194..324 CDD:175992
S_TKc 371..629 CDD:214567 94/316 (30%)
STKc_PKC 375..692 CDD:270722 100/340 (29%)
WAG1NP_175774.1 STKc_phototropin_like 91..416 CDD:270726 99/336 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 206 1.000 Inparanoid score I1276
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.