DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inaC and AT1G48590

DIOPT Version :10

Sequence 1:NP_476863.1 Gene:inaC / 36897 FlyBaseID:FBgn0004784 Length:700 Species:Drosophila melanogaster
Sequence 2:NP_001185174.1 Gene:AT1G48590 / 841280 AraportID:AT1G48590 Length:200 Species:Arabidopsis thaliana


Alignment Length:92 Identity:34/92 - (36%)
Similarity:52/92 - (56%) Gaps:8/92 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   208 LKVDIKEAANLIPMDTNGFSDPYIAVQMHPDRSGRTKKKTKTIQKNLNPVFNETFTFELQPQDRD 272
            |::.||...||...|.|. ||||:.|:|     .:.|.||:.|.||:||.:||..|  |...|.:
plant    44 LRIRIKRGVNLAVRDLNS-SDPYVVVKM-----AKQKLKTRVIYKNVNPEWNEDLT--LSVSDPN 100

  Fly   273 KRLLIEVWDWDRTSRNDFMGSFSFSLE 299
            ..:|:.|:|:|..:::|.||...|.::
plant   101 LTVLLTVYDYDTFTKDDKMGDAEFGIK 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
inaCNP_476863.1 C1_cPKC_nPKC_rpt1 71..123 CDD:410342
C1 137..190 CDD:412127
C2_PKC_alpha_gamma 194..324 CDD:175992 34/92 (37%)
STKc_PKC 375..692 CDD:270722
AT1G48590NP_001185174.1 C2_ArfGAP 41..184 CDD:176003 34/92 (37%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.