DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inaC and D6PKL1

DIOPT Version :9

Sequence 1:NP_476863.1 Gene:inaC / 36897 FlyBaseID:FBgn0004784 Length:700 Species:Drosophila melanogaster
Sequence 2:NP_194391.1 Gene:D6PKL1 / 828768 AraportID:AT4G26610 Length:506 Species:Arabidopsis thaliana


Alignment Length:409 Identity:119/409 - (29%)
Similarity:171/409 - (41%) Gaps:94/409 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   361 SKRDMIRAADFNFVKVIGKGSFGKVLLAERRGTDELYAVKVLRKDVIIQTDDMELPMNEKKILAL 425
            :|..::....|..:|.:|.|..|.|.|||..||...:|:||:.|..:.....:.....|::||..
plant   113 TKHGVLGLNHFRLLKRLGCGDIGTVHLAELHGTRCFFAMKVMDKGALASRKKLLRAQTEREILQC 177

  Fly   426 SGRPPFLVSMHSCFQTMDRLFFVMEYCKGGDL--MYHMQQYGRFKESVAIFYAVEVAIALFFLHE 488
            ... |||.:::|.|:|......|||:|.||||  :...|...||.|..|.||..||.:|:.:||.
plant   178 LDH-PFLPTLYSHFETEKFSCLVMEFCPGGDLHTLRQRQPGKRFSEQAAKFYVAEVLLAMEYLHM 241

  Fly   489 RDIIYRDLKLDNILLDGEGHVKLVDFGLS----------------KEG----------------- 520
            ..|||||||.:|:|:..:|||.|.||.||                .||                 
plant   242 LGIIYRDLKPENVLVRDDGHVMLSDFDLSLRCTVSPTVVRSTVLASEGQKNSGYCAQPACIQQPS 306

  Fly   521 --------------------------------------VTERQTTR--TFCGTPNYMAPEIVSYD 545
                                                  |.|..:.|  :|.||..|:||||:..:
plant   307 CISAPTTCFSPRYFSSKSKKDKKMKNETGNQVSPLPELVAEPTSARSMSFVGTHEYLAPEIIKGE 371

  Fly   546 PYSIAADWWSFGVLLFEFMAGQAPFEGDDETTVFRNIKDKKAVFPKH--FSVEAMDIITSFLTKK 608
            .:..|.|||:||:.|:|.:.|:.||:|........|:..:...||:.  .|..|.|:|.|.|.|:
plant   372 GHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNVVGQPLRFPESPVVSFAARDLIRSLLVKE 436

  Fly   609 PNNRLGAGRYARQEITTHPFFRNVDWDKAEACEMEPPIKPMIKHRKDISNFDDAFTKEKTDLTPT 673
            |.:||...|.| .|:..||||..|:|.... |...|.|...:.:             |....||.
plant   437 PQHRLAYKRGA-TEMKQHPFFEGVNWALVR-CASPPEIPKPVDY-------------ESAPATPA 486

  Fly   674 DKL-FMMNLDQNDFIGFSF 691
            ... ..:..||::::.|.|
plant   487 AATSTSVKSDQSNYLEFDF 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
inaCNP_476863.1 C1_1 72..124 CDD:278556
C1_1 137..189 CDD:278556
C2_PKC_alpha_gamma 194..324 CDD:175992
S_TKc 371..629 CDD:214567 104/334 (31%)
STKc_PKC 375..692 CDD:270722 117/395 (30%)
D6PKL1NP_194391.1 STKc_phototropin_like 122..477 CDD:270726 111/357 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 206 1.000 Inparanoid score I1276
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.