DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inaC and AT4G10010

DIOPT Version :9

Sequence 1:NP_476863.1 Gene:inaC / 36897 FlyBaseID:FBgn0004784 Length:700 Species:Drosophila melanogaster
Sequence 2:NP_001328367.1 Gene:AT4G10010 / 826592 AraportID:AT4G10010 Length:649 Species:Arabidopsis thaliana


Alignment Length:268 Identity:70/268 - (26%)
Similarity:111/268 - (41%) Gaps:39/268 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   367 RAADFNFVKVIGKGSFGKVLLAERRGTDELYAVKVLRKDVIIQTDDMELPMNEKKILALSGRPPF 431
            ||..|..:..||:|::..|..|....|.::.|:|.:| .|.:..:.:.....|..||.....|. 
plant   152 RAESFEKLDKIGQGTYSSVYRARDLETGKMVAMKKVR-FVNMDPESVRFMAREINILRKLDHPN- 214

  Fly   432 LVSMHSCFQT---MDRLFFVMEYCKGGDLMYH------MQQYGRFKESVAIFYAVEVAIALFFLH 487
             |....|..|   ...|:.|.||      |.|      ::...:|.||....|..::...|...|
plant   215 -VMKLECLVTSKLSGSLYLVFEY------MEHDLSGLALRPGVKFTESQIKCYMKQLLSGLEHCH 272

  Fly   488 ERDIIYRDLKLDNILLDGEGHVKLVDFGLSK-------EGVTERQTTRTFCGTPNYMAPEIV--- 542
            .|.|::||:|..|:|::.:|.:|:.||||:.       :.:|.|..|..      |.|||::   
plant   273 SRGILHRDIKGPNLLVNNDGVLKIGDFGLANIYHPEQDQPLTSRVVTLW------YRAPELLLGA 331

  Fly   543 -SYDPYSIAADWWSFGVLLFEFMAGQAPFEGDDETTVFRNI-KDKKAVFPKHFSVEAMDIITSFL 605
             .|.|   ..|.||.|.:|.|...|:....|..|......| |...:....::....:.:.|||.
plant   332 TEYGP---GIDLWSVGCILTELFLGKPIMPGRTEVEQMHKIFKFCGSPSDDYWQKTKLPLATSFK 393

  Fly   606 TKKPNNRL 613
            .::|..|:
plant   394 PQQPYKRV 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
inaCNP_476863.1 C1_1 72..124 CDD:278556
C1_1 137..189 CDD:278556
C2_PKC_alpha_gamma 194..324 CDD:175992
S_TKc 371..629 CDD:214567 68/264 (26%)
STKc_PKC 375..692 CDD:270722 67/260 (26%)
AT4G10010NP_001328367.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.