DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inaC and AGD13

DIOPT Version :10

Sequence 1:NP_476863.1 Gene:inaC / 36897 FlyBaseID:FBgn0004784 Length:700 Species:Drosophila melanogaster
Sequence 2:NP_567292.1 Gene:AGD13 / 825881 AraportID:AT4G05330 Length:336 Species:Arabidopsis thaliana


Alignment Length:94 Identity:30/94 - (31%)
Similarity:49/94 - (52%) Gaps:8/94 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   208 LKVDIKEAANLIPMDTNGFSDPYIAVQMHPDRSGRTKKKTKTIQKNLNPVFNETFTFELQPQDRD 272
            |||.||:..||...|... ||||:.:.:     |:.|.:|..:..|||||:|:.....: |:...
plant   182 LKVTIKKGTNLAIRDMMS-SDPYVVLNL-----GKQKLQTTVMNSNLNPVWNQELMLSV-PESYG 239

  Fly   273 KRLLIEVWDWDRTSRNDFMGSFSFSLEEL 301
            . :.::|:|:|..|.:|.||.....::.|
plant   240 P-VKLQVYDYDTFSADDIMGEADIDIQPL 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
inaCNP_476863.1 C1_cPKC_nPKC_rpt1 71..123 CDD:410342
C1 137..190 CDD:412127
C2_PKC_alpha_gamma 194..324 CDD:175992 30/94 (32%)
STKc_PKC 375..692 CDD:270722
AGD13NP_567292.1 ArfGap 18..124 CDD:350058
C2_ArfGAP 179..323 CDD:176003 30/94 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.