DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inaC and AT3G44610

DIOPT Version :9

Sequence 1:NP_476863.1 Gene:inaC / 36897 FlyBaseID:FBgn0004784 Length:700 Species:Drosophila melanogaster
Sequence 2:NP_190047.2 Gene:AT3G44610 / 823587 AraportID:AT3G44610 Length:451 Species:Arabidopsis thaliana


Alignment Length:404 Identity:113/404 - (27%)
Similarity:167/404 - (41%) Gaps:95/404 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   345 PNEKRRMDNKDMPHNMSKRDMIRAADFNFVKVIGKGSFGKVLLAERRGTD----------ELYAV 399
            |:......:..:|.::  |..:..:|..|...:|.|..|.|.|||.:...          .|.|.
plant    45 PSAHGSFSSSKLPPSL--RSSLSLSDLRFRLRLGSGDIGSVFLAEFKSLTAVTETTAVKLPLLAA 107

  Fly   400 KVLRKDVIIQTDDMELPMNEKKILALSGRPPFLVSMHSCFQTMDRLFFVMEYCKGGDL--MYHMQ 462
            ||:.|..:...........|::||. |...|||.::::...:...|..:.|:|.||||  :...|
plant   108 KVMDKKELASRSKEGRAKTEREILE-SLDHPFLPTLYAAIDSPKWLCLLTEFCPGGDLHVLRQKQ 171

  Fly   463 QYGRFKESVAIFYAVEVAIALFFLHERDIIYRDLKLDNILLDGEGHVKLVDFGLS---------- 517
            .:.||.||...||..||.:|:.:||...|:|||||.:|:|:..:||:.|.||.||          
plant   172 THKRFHESAVRFYVSEVIVAIEYLHMLGIVYRDLKPENVLVRSDGHIMLTDFDLSLKCDESTSTP 236

  Fly   518 ------------------KEGVTERQTTRTFC--------------------------------- 531
                              .:|:..||||.:.|                                 
plant   237 QIVLNRNNLPNGSSDQNENQGMDHRQTTSSSCMIPNCIVPAVSCFHPRIRRRKKKTDHRNNGPEL 301

  Fly   532 -------------GTPNYMAPEIVSYDPYSIAADWWSFGVLLFEFMAGQAPFEGDDETTVFRNIK 583
                         ||..|:||||||.:.:..|.|||:.|:.:||...|..||:|.|......||.
plant   302 VAEPVDVRSMSFVGTHEYLAPEIVSGEGHGSAVDWWTLGIFMFELFYGTTPFKGMDHELTLANIV 366

  Fly   584 DKKAVFPKHFSV--EAMDIITSFLTKKPNNRLGAGRYARQEITTHPFFRNVDWDKAEACEMEPPI 646
            .:...|||..::  .|.|:|:..|.|.|:.|||:...| ..:..||||:.|:|  |......||.
plant   367 ARALEFPKEPTIPSAAKDLISQLLAKDPSRRLGSSLGA-TAVKRHPFFQGVNW--ALLMCTRPPF 428

  Fly   647 KPMIKHRKDISNFD 660
            .|. ..||::.:.|
plant   429 LPP-PFRKELLSDD 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
inaCNP_476863.1 C1_1 72..124 CDD:278556
C1_1 137..189 CDD:278556
C2_PKC_alpha_gamma 194..324 CDD:175992
S_TKc 371..629 CDD:214567 98/345 (28%)
STKc_PKC 375..692 CDD:270722 108/374 (29%)
AT3G44610NP_190047.2 PKc_like 71..424 CDD:304357 103/356 (29%)
S_TKc 75..413 CDD:214567 97/339 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 206 1.000 Inparanoid score I1276
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.