DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inaC and ATPK7

DIOPT Version :9

Sequence 1:NP_476863.1 Gene:inaC / 36897 FlyBaseID:FBgn0004784 Length:700 Species:Drosophila melanogaster
Sequence 2:NP_001030784.1 Gene:ATPK7 / 822380 AraportID:AT3G27580 Length:578 Species:Arabidopsis thaliana


Alignment Length:397 Identity:124/397 - (31%)
Similarity:175/397 - (44%) Gaps:92/397 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   343 RRPNEKRRMDNKDMPHNMSKRDMIRAADFNFVKVIGKGSFGKVLLAERRGTDELYAVKVLRKDVI 407
            |..|:||.:..:::...:.  ..:.|.||..:|.:|.|..|.|.|||..||...:||||:.|..|
plant   156 RDNNDKRWVAIQEVRSRVG--SSLEAKDFKLIKKLGGGDIGNVYLAELIGTGVSFAVKVMEKAAI 218

  Fly   408 IQTDDMELPMNEKKILALSGRPPFLVSMHSCFQTMDRLFFVMEYCKGGDL-MYHMQQYGR-FKES 470
            .....:.....||:||. |...|||.:::|.|:|......|||:|.|||| ....:|.|: |.|.
plant   219 AARKKLVRAQTEKEILQ-SLDHPFLPTLYSHFETEMNSCLVMEFCPGGDLHSLRQKQRGKYFPEQ 282

  Fly   471 VAIFYAVEVAIALFFLHERDIIYRDLKLDNILLDGEGHVKLVDFGLS------------------ 517
            .|.||..||.:|:.:||...|||||||.:|:|:..:||:.|.||.||                  
plant   283 AARFYVAEVLLAMEYLHMLGIIYRDLKPENVLVREDGHIMLSDFDLSLRCAVSPTLVRFAAITLE 347

  Fly   518 ------------------------------------------------------KEGVTERQTTR 528
                                                                  .|.:.|..:.|
plant   348 SKSSSYCIQPTCVDQSSCIVQPDCIQPVCFTPRFLSKGKHRKKSNDMSRQIRPLPELIAEPTSAR 412

  Fly   529 --TFCGTPNYMAPEIVSYDPYSIAADWWSFGVLLFEFMAGQAPFEGDDETTVFRNIKDKKAVFPK 591
              :|.||..|:||||:..:.:..|.|||:||:.|:|.:.|..||.|.|......|:..:...||:
plant   413 SMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGITPFRGGDNRATLFNVVGQPLRFPE 477

  Fly   592 H--FSVEAMDIITSFLTKKPNNRLGAGRYARQEITTHPFFRNVDWDKAEACEMEP----PIKPM- 649
            |  .|..|.|:|...|.|:|.:|| |.|....||..||||::|:|.... |...|    |:||| 
plant   478 HPNVSFAARDLIRGLLVKEPQHRL-AYRRGATEIKQHPFFQSVNWALIR-CTSPPQIPQPVKPMD 540

  Fly   650 ----IKH 652
                ::|
plant   541 QAHSVRH 547

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
inaCNP_476863.1 C1_1 72..124 CDD:278556
C1_1 137..189 CDD:278556
C2_PKC_alpha_gamma 194..324 CDD:175992
S_TKc 371..629 CDD:214567 107/335 (32%)
STKc_PKC 375..692 CDD:270722 117/365 (32%)
ATPK7NP_001030784.1 STKc_phototropin_like 180..540 CDD:270726 117/362 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 206 1.000 Inparanoid score I1276
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.