DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inaC and PKN1

DIOPT Version :9

Sequence 1:NP_476863.1 Gene:inaC / 36897 FlyBaseID:FBgn0004784 Length:700 Species:Drosophila melanogaster
Sequence 2:NP_998725.1 Gene:PKN1 / 5585 HGNCID:9405 Length:948 Species:Homo sapiens


Alignment Length:532 Identity:181/532 - (34%)
Similarity:269/532 - (50%) Gaps:76/532 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   196 KLLLYVELKGNNLKVDIKEAANLIPMDTNGFSDPYIAVQMHPDRSGRTKKKTKTIQKNLNPVFNE 260
            ||..:::.:.:.:::|::....|:...|  |.:|.|      :|..|.:::.|...|.....|  
Human   454 KLEDFLDNERHEVQLDMEPQGCLVAEVT--FRNPVI------ERIPRLRRQKKIFSKQQGKAF-- 508

  Fly   261 TFTFELQPQDRDKRLLIEVWDWDRTSRN-----DFMGSFSFSLEELQKEPVDGWYKFLSQVEGEH 320
                     .|.:::.|:|..|.|..|.     ...|:||.......:....|      .:..|.
Human   509 ---------QRARQMNIDVATWVRLLRRLIPNATGTGTFSPGASPGSEARTTG------DISVEK 558

  Fly   321 YNIPCVDAFNDIARLRDEVRHDRRPNEKRRMDNKDMPHNMS------------------------ 361
            .|:. .|:             |..|.:..| |....|.::|                        
Human   559 LNLG-TDS-------------DSSPQKSSR-DPPSSPSSLSSPIQESTAPELPSETQETPGPALC 608

  Fly   362 ---KRDMIRAADFNFVKVIGKGSFGKVLLAERRGTDELYAVKVLRKDVIIQTDDMELPMNEKKIL 423
               ::..:...||.|:.|:|:|.||||||:|.|.:.||:|:|.|:|..|:..|::|..|.||:||
Human   609 SPLRKSPLTLEDFKFLAVLGRGHFGKVLLSEFRPSGELFAIKALKKGDIVARDEVESLMCEKRIL 673

  Fly   424 A--LSGRPPFLVSMHSCFQTMDRLFFVMEYCKGGDLMYHMQQYGRFKESVAIFYAVEVAIALFFL 486
            |  .|...||||::..||||.:.:.|||||..|||||.|:.. ..|.|..||||:..|.:.|.||
Human   674 AAVTSAGHPFLVNLFGCFQTPEHVCFVMEYSAGGDLMLHIHS-DVFSEPRAIFYSACVVLGLQFL 737

  Fly   487 HERDIIYRDLKLDNILLDGEGHVKLVDFGLSKEGVTERQTTRTFCGTPNYMAPEIVSYDPYSIAA 551
            ||..|:||||||||:|||.||:||:.||||.|||:.....|.||||||.::|||:::...|:.|.
Human   738 HEHKIVYRDLKLDNLLLDTEGYVKIADFGLCKEGMGYGDRTSTFCGTPEFLAPEVLTDTSYTRAV 802

  Fly   552 DWWSFGVLLFEFMAGQAPFEGDDETTVFRNIKDKKAVFPKHFSVEAMDIITSFLTKKPNNRLGAG 616
            |||..||||:|.:.|::||.||||..||.:|.:.:..:|:..|.||:.|:...|.:.|..|||:.
Human   803 DWWGLGVLLYEMLVGESPFPGDDEEEVFDSIVNDEVRYPRFLSAEAIGIMRRLLRRNPERRLGSS 867

  Fly   617 RYARQEITTHPFFRNVDWDKAEACEMEPPIKPMIKHRKDISNFDDAFTKEKTDLT-PTDKLFMMN 680
            ....:::...||||.:.|:...|..:.||..|.:..|.|:||||:.||.|...|: |.|...:..
Human   868 ERDAEDVKKQPFFRTLGWEALLARRLPPPFVPTLSGRTDVSNFDEEFTGEAPTLSPPRDARPLTA 932

  Fly   681 LDQNDFIGFSFM 692
            .:|..|:.|.|:
Human   933 AEQAAFLDFDFV 944

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
inaCNP_476863.1 C1_1 72..124 CDD:278556
C1_1 137..189 CDD:278556
C2_PKC_alpha_gamma 194..324 CDD:175992 25/132 (19%)
S_TKc 371..629 CDD:214567 124/259 (48%)
STKc_PKC 375..692 CDD:270722 145/319 (45%)
PKN1NP_998725.1 HR1_PKN_1 <52..104 CDD:212012
HR1_PKN1_2 127..202 CDD:212020
HR1_PKN1_3 211..284 CDD:212026
C2_PKN-like 395..482 CDD:176069 5/29 (17%)
STKc_PKN 621..945 CDD:270741 148/325 (46%)
S_TKc 621..880 CDD:214567 124/259 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149245
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.