DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inaC and gwl

DIOPT Version :9

Sequence 1:NP_476863.1 Gene:inaC / 36897 FlyBaseID:FBgn0004784 Length:700 Species:Drosophila melanogaster
Sequence 2:NP_524860.2 Gene:gwl / 45969 FlyBaseID:FBgn0260399 Length:846 Species:Drosophila melanogaster


Alignment Length:164 Identity:68/164 - (41%)
Similarity:98/164 - (59%) Gaps:3/164 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   357 PHNMSKRDMI-RAADFNFVKVIGKGSFGKVLLA-ERRGTDELYAVKVLRKDVIIQTDDMELPMNE 419
            |.|.|:...: ...||..:|.|.:|:||||.|. :...:..|:|:||:||..:|..:.:...:.|
  Fly    42 PENHSQNAKLPTIKDFVIIKPISRGAFGKVFLGYKNNDSKRLFAIKVMRKSEMINKNMVSQVITE 106

  Fly   420 KKILALSGRPPFLVSMHSCFQTMDRLFFVMEYCKGGDLMYHMQQYGRFKESVAIFYAVEVAIALF 484
            :..|||| |..|.||:....|::..::.||||..||||...:..:|.|.|..|.||..|:.:||.
  Fly   107 RNALALS-RSQFCVSLFYSLQSLSYVYLVMEYMVGGDLKSLLAMFGYFDEPTARFYVAEMVMALQ 170

  Fly   485 FLHERDIIYRDLKLDNILLDGEGHVKLVDFGLSK 518
            :||:..|::||:|.||:||...|||||.||||||
  Fly   171 YLHQHGIVHRDIKPDNMLLSSSGHVKLTDFGLSK 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
inaCNP_476863.1 C1_1 72..124 CDD:278556
C1_1 137..189 CDD:278556
C2_PKC_alpha_gamma 194..324 CDD:175992
S_TKc 371..629 CDD:214567 64/149 (43%)
STKc_PKC 375..692 CDD:270722 63/145 (43%)
gwlNP_524860.2 STKc_MASTL 52..>255 CDD:270761 65/154 (42%)
S_TKc 57..>205 CDD:214567 64/149 (43%)
PKc_like <655..835 CDD:304357
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24356
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.