DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inaC and wts

DIOPT Version :9

Sequence 1:NP_476863.1 Gene:inaC / 36897 FlyBaseID:FBgn0004784 Length:700 Species:Drosophila melanogaster
Sequence 2:NP_733403.1 Gene:wts / 43651 FlyBaseID:FBgn0011739 Length:1105 Species:Drosophila melanogaster


Alignment Length:588 Identity:156/588 - (26%)
Similarity:260/588 - (44%) Gaps:131/588 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 CENCNLNVHHACQETVPPMCGADISEVRGKLLLYVELKGNNLKVDIKEAANLIPMDTNGFSDPYI 231
            |.|.|:.:.::...|.||:..|               |.||      .::|.....:.|.:    
  Fly   565 CNNNNIQISNSNLATTPPIPPA---------------KYNN------NSSNTGANSSGGSN---- 604

  Fly   232 AVQMHPDRSGRTKKKTKTIQ--KNLNPVFNETFTFELQPQDRDKRLLIEVWDWDRTSRNDFMGSF 294
                  ..:|.|...:.:.:  |:.:|: .|......:.::..|...|         |.....:|
  Fly   605 ------GSTGTTASSSTSCKKIKHASPI-PERKKISKEKEEERKEFRI---------RQYSPQAF 653

  Fly   295 SFSLEELQKEPVDGW----YKFLSQVEGEHYNIPCVDAFNDIARLRDEVRHDRRPNEKRRMDNKD 355
            .|.:|:..:..:..:    |: .:|:|.|.:.:          .|.|:.:.:.|    :.::.|:
  Fly   654 KFFMEQHIENVIKSYRQRTYR-KNQLEKEMHKV----------GLPDQTQIEMR----KMLNQKE 703

  Fly   356 MPHNMSKRDMIRAADFNFVKVIGKGSFGKVLLAERRGT-DELYAVKVLRKDVIIQTDDMELPMNE 419
            ..:...||..:..:.|..:|.||.|:||:|.|..:..| :.|||:|.|||..:::.:.:.....|
  Fly   704 SNYIRLKRAKMDKSMFVKLKPIGVGAFGEVTLVSKIDTSNHLYAMKTLRKADVLKRNQVAHVKAE 768

  Fly   420 KKILALSGRPPFLVSMHSCFQTMDRLFFVMEYCKGGDLMYHMQQYGRFKESVAIFYAVEVAIALF 484
            :.|||.:.. .::|.::..||..|.|:|||:|..|||||..:.:.|.|:|.:|.||..||..|:.
  Fly   769 RDILAEADN-NWVVKLYYSFQDKDNLYFVMDYIPGGDLMSLLIKLGIFEEELARFYIAEVTCAVD 832

  Fly   485 FLHERDIIYRDLKLDNILLDGEGHVKLVDFGL-------------------------------SK 518
            .:|:...|:||:|.||||:|.:||:||.||||                               |:
  Fly   833 SVHKMGFIHRDIKPDNILIDRDGHIKLTDFGLCTGFRWTHNSKYYQENGNHSRQDSMEPWEEYSE 897

  Fly   519 EG----VTERQTTR--------TFCGTPNYMAPEIVSYDPYSIAADWWSFGVLLFEFMAGQAPFE 571
            .|    |.||:..|        :..|||||:|||::....|:...|:||.||:|:|.:.||.||.
  Fly   898 NGPKPTVLERRRMRDHQRVLAHSLVGTPNYIAPEVLERSGYTQLCDYWSVGVILYEMLVGQPPFL 962

  Fly   572 GDDETTVFRNI--KDKKAVFP--KHFSVEAMDIITSFLTKKPNNRLGAGRYARQEITTHPFFRNV 632
            .:......:.:  .:|....|  ...|.||.|:|.. |....:.|||.   :..|:.:|.||:.:
  Fly   963 ANSPLETQQKVINWEKTLHIPPQAELSREATDLIRR-LCASADKRLGK---SVDEVKSHDFFKGI 1023

  Fly   633 DWDKAEACEMEPPIKPMIKHRKDISNFD----DAFTKEKTDLTPTDKLFMMNLDQND-----FIG 688
            |:  |:..:.:.|..|.|||..|.||||    :......:.::..|     ::||||     |..
  Fly  1024 DF--ADMRKQKAPYIPEIKHPTDTSNFDPVDPEKLRSNDSTMSSGD-----DVDQNDRTFHGFFE 1081

  Fly   689 FSF 691
            |:|
  Fly  1082 FTF 1084

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
inaCNP_476863.1 C1_1 72..124 CDD:278556
C1_1 137..189 CDD:278556 6/21 (29%)
C2_PKC_alpha_gamma 194..324 CDD:175992 20/135 (15%)
S_TKc 371..629 CDD:214567 101/305 (33%)
STKc_PKC 375..692 CDD:270722 122/374 (33%)
wtsNP_733403.1 STKc_LATS 717..1078 CDD:270749 120/372 (32%)
S_TKc 719..1020 CDD:214567 101/305 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24356
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.