DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inaC and RhoGAP5A

DIOPT Version :10

Sequence 1:NP_476863.1 Gene:inaC / 36897 FlyBaseID:FBgn0004784 Length:700 Species:Drosophila melanogaster
Sequence 2:NP_727007.1 Gene:RhoGAP5A / 31473 FlyBaseID:FBgn0029778 Length:494 Species:Drosophila melanogaster


Alignment Length:237 Identity:57/237 - (24%)
Similarity:79/237 - (33%) Gaps:90/237 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 HRFGVRFFKNPTYCGHCKDFIWGFGKQGFQCEECRFNIHQKCCKFVVFKCPGKDTDFDADCAKVK 136
            |.|.|..||...:|..|.:|:|||..||.:||.|.|..|.||.:.|..||.       .|..:::
  Fly   242 HHFKVHTFKGLNWCEFCANFLWGFTAQGVKCEACGFVAHSKCSELVPPKCV-------PDLKRIR 299

  Fly   137 HGWISTTYTTPTFCDECGLLLHGVAHQGVKCENCNLNVHH-------ACQETVPPMCGADISEVR 194
             |...|..||..                      .|..||       .|.|.|         |.|
  Fly   300 -GVFGTDLTTMV----------------------QLEPHHQIPFVVRRCVEEV---------EAR 332

  Fly   195 GKLLLYVELKGNNLKVDIKEAANLIPMDTNGFSDPYIAVQMHPDRSGRTKKKTKTIQKNLN---- 255
            |.|               :|....:    :||:|...|:::..||.|.....::|...|:|    
  Fly   333 GML---------------QEGIYRV----SGFADEIEALKLALDREGEKTDMSETAYGNVNVIAG 378

  Fly   256 ---------PVFNETFTFELQP----------QDRDKRLLIE 278
                     ||  ...||:..|          |...::|:.|
  Fly   379 TLKLYLRLLPV--PLITFQAYPSFMAAGRTGKQAEQRQLMAE 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
inaCNP_476863.1 C1_cPKC_nPKC_rpt1 71..123 CDD:410342 23/50 (46%)
C1 137..190 CDD:412127 10/59 (17%)
C2_PKC_alpha_gamma 194..324 CDD:175992 22/108 (20%)
STKc_PKC 375..692 CDD:270722
RhoGAP5ANP_727007.1 SH2_a2chimerin_b2chimerin 75..166 CDD:198215
C1_CHN 241..293 CDD:410356 23/57 (40%)
RhoGAP_chimaerin 302..491 CDD:239837 32/169 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.