DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inaC and F48G7.10

DIOPT Version :10

Sequence 1:NP_476863.1 Gene:inaC / 36897 FlyBaseID:FBgn0004784 Length:700 Species:Drosophila melanogaster
Sequence 2:NP_503273.1 Gene:F48G7.10 / 185998 WormBaseID:WBGene00018621 Length:168 Species:Caenorhabditis elegans


Alignment Length:140 Identity:48/140 - (34%)
Similarity:69/140 - (49%) Gaps:22/140 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 VNGHRFGVRFFKNPTYCGHCKDFIWGFGKQGFQCEECRFNIHQKCCKFVVFKC---PGK-----D 125
            ::||||.......||.|..|...|:|.||||::|..|...:|::|...:..:|   |..     .
 Worm    24 ISGHRFKATALVQPTCCAICSKLIYGLGKQGYRCLGCETVVHKRCHSLINDRCNFGPSSPRQPPP 88

  Fly   126 TDFDADCAKVKHGWISTT--------------YTTPTFCDECGLLLHGVAHQGVKCENCNLNVHH 176
            .:..:|..:::|...|.|              ||.|||||.||.||:|::.|||:|.:|..||||
 Worm    89 QELSSDSGELRHRIPSPTEPQVSTNHHFNKHFYTRPTFCDHCGSLLYGLSKQGVQCSDCLANVHH 153

  Fly   177 ACQETVPPMC 186
            .|:|.....|
 Worm   154 RCKEKAVHNC 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
inaCNP_476863.1 C1_cPKC_nPKC_rpt1 71..123 CDD:410342 19/54 (35%)
C1 137..190 CDD:412127 27/64 (42%)
C2_PKC_alpha_gamma 194..324 CDD:175992
STKc_PKC 375..692 CDD:270722
F48G7.10NP_503273.1 C1 20..76 CDD:412127 18/51 (35%)
C1_cPKC_nPKC_rpt2 114..163 CDD:410343 23/48 (48%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.