DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6472 and CG34447

DIOPT Version :9

Sequence 1:NP_611166.2 Gene:CG6472 / 36895 FlyBaseID:FBgn0034166 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_001097060.1 Gene:CG34447 / 5740813 FlyBaseID:FBgn0085476 Length:389 Species:Drosophila melanogaster


Alignment Length:304 Identity:111/304 - (36%)
Similarity:152/304 - (50%) Gaps:29/304 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 RGSCSTCCAIKEREDIKFMLYTSRNRNSAQLLHLSDDARLAQSNFNFNYPLAIYLHGFSESATGE 93
            ||.|       ..::|.|.||::..|.:..||   |...|...||....||.|.:||:    ||:
  Fly    34 RGEC-------PNKNISFWLYSNSTRENPILL---DPLDLNPWNFQPPRPLKILIHGY----TGD 84

  Fly    94 RQ--SSQELKDAFLRRGNYNVILIDWSAMTAVPWYSNAVENLPVSGRYLARFLRFLVDKGYPAK- 155
            |.  .:..::...|...:..||.||:..:...|.|..||:|||:..|.||:.:..|||:...|. 
  Fly    85 RDFAPNSYIRPVLLDHEDVYVISIDYGPLVRYPCYIQAVQNLPLVSRCLAQLINNLVDRAIVAND 149

  Fly   156 YIHLIGFSLGAEVAGFAGKQLQEWGIKLPRITALDPALPLFEGNSSNRRLSPSDARFVDVIHTDG 220
            .|||||||||.:|||.....::.   |:.|||.||||.|||.....:|||...||.||||||||.
  Fly   150 QIHLIGFSLGGQVAGQTANYVKR---KMKRITGLDPAKPLFILGPDSRRLDKGDADFVDVIHTDV 211

  Fly   221 GLLGNPAPMGHADFYPNGGRPLQPGCAKQNIANNWLGIIVGCSHQRAWEYFVESIAQPRGFPAQR 285
            ...|.....||.|||||.|.. ||||.::|:.:.     ..|:|:||..::.|||....||.|::
  Fly   212 FGRGYLRAAGHVDFYPNFGAK-QPGCMEENMQDP-----SSCNHERAPRFYAESINTTVGFWARQ 270

  Fly   286 CEP--SDMFGICREPGGGPAFMGMGADPRIRGKFYLDTNDAKPF 327
            |..  ..:..:| ...|..|.:|......:||.::|.|....|:
  Fly   271 CSGWLLQLLTLC-PTTGAQALLGYHVSDELRGSYFLQTASKSPY 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6472NP_611166.2 Pancreat_lipase_like 43..323 CDD:238363 107/284 (38%)
CG34447NP_001097060.1 Pancreat_lipase_like 41..309 CDD:238363 107/284 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445996
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.