DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6472 and CG34448

DIOPT Version :9

Sequence 1:NP_611166.2 Gene:CG6472 / 36895 FlyBaseID:FBgn0034166 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_001097059.1 Gene:CG34448 / 5740554 FlyBaseID:FBgn0085477 Length:344 Species:Drosophila melanogaster


Alignment Length:313 Identity:112/313 - (35%)
Similarity:151/313 - (48%) Gaps:27/313 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 RGSCSTCCAIKERE----DIKFMLYTSRNRNSAQLLHLSDDARLAQSNFNFNYPLAIYLHGFSES 89
            ||.....|.:.|::    .:.|.|||::.|:....|   |.....:..|....||.|.:|||   
  Fly    25 RGWLPEFCVVGEQKCPNSRVSFWLYTNQTRDDPIQL---DPLNPQKDVFQPRLPLKILIHGF--- 83

  Fly    90 ATGERQ--SSQELKDAFLRRGNYNVILIDWSAMTAVP-WYSNAVENLPVSGRYLARFLRFLVDKG 151
             .|.|.  .:.|::|..|:....|||.:|:..:...| :|..||.|.|:....||:.:..|:..|
  Fly    84 -IGNRNLTPNLEVRDVLLQTQPINVISVDYGTLVRWPCYYPWAVNNAPIVSECLAQMINNLISAG 147

  Fly   152 YPAKY-IHLIGFSLGAEVAGFAGKQLQEWGIKLPRITALDPALPLFEGNSS-NRRLSPSDARFVD 214
            ...:. ||||||||||:|||.....:.:   .|.|||.||||.|.|....| .::|..|||.|||
  Fly   148 ISRREDIHLIGFSLGAQVAGMVANYVSQ---PLARITGLDPAGPGFMMQPSLQQKLDASDADFVD 209

  Fly   215 VIHTDGGLLGNPAPMGHADFYPNGGRPLQPGCAKQNIANNWLGIIVGCSHQRAWEYFVESIAQPR 279
            :||||........||||||||||..:..|.||   :..:||.  ...|:|.||..|:.|||...|
  Fly   210 IIHTDPFFFSMLPPMGHADFYPNLDQLNQRGC---SYISNWR--FYNCNHYRAAVYYGESIISER 269

  Fly   280 GFPAQRCEP-SDMFG-ICREPGGGP-AFMGMGADPRIRGKFYLDTNDAKPFGR 329
            ||.||:|.. .|.|. .|......| ..||........|.::|.|::..||.:
  Fly   270 GFWAQQCGGWFDFFSQRCSHYSNMPNTQMGYFVSEDASGSYFLTTHEVAPFAK 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6472NP_611166.2 Pancreat_lipase_like 43..323 CDD:238363 106/287 (37%)
CG34448NP_001097059.1 Pancreat_lipase_like 44..316 CDD:238363 106/286 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445998
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.