DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6472 and PNLIPRP2

DIOPT Version :9

Sequence 1:NP_611166.2 Gene:CG6472 / 36895 FlyBaseID:FBgn0034166 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_005387.3 Gene:PNLIPRP2 / 5408 HGNCID:9157 Length:469 Species:Homo sapiens


Alignment Length:318 Identity:111/318 - (34%)
Similarity:158/318 - (49%) Gaps:49/318 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 DIKFMLYTSRNRNSAQLLHLSDDARLAQSNFNFNYPLAIYLHGFSESATGERQSSQELKDAFLRR 107
            |.:|:|||:.|.|:.||:..::...:..|||..:......:|||.:.|  |.....::.......
Human    53 DTRFLLYTNENPNNFQLITGTEPDTIEASNFQLDRKTRFIIHGFLDKA--EDSWPSDMCKKMFEV 115

  Fly   108 GNYNVILIDW----SAMTAVPWYSNAVENLPVSGRYLARFLRFL-VDKGYPAKYIHLIGFSLGAE 167
            ...|.|.:||    .||     |:.||:|:.|.|...|..::.| ...||..:.:|:||.||||.
Human   116 EKVNCICVDWRHGSRAM-----YTQAVQNIRVVGAETAFLIQALSTQLGYSLEDVHVIGHSLGAH 175

  Fly   168 VAGFAGKQLQEWGIKLPRITALDPALPLFEGNSSNRRLSPSDARFVDVIHTDGGLL------GNP 226
            .|..||::|   |.::.|||.||||.|.|:......||.||||.||||||||...:      |..
Human   176 TAAEAGRRL---GGRVGRITGLDPAGPCFQDEPEEVRLDPSDAVFVDVIHTDSSPIVPSLGFGMS 237

  Fly   227 APMGHADFYPNGGRPLQPGCAKQNIANN-------WLGI--IVGCSHQRAWEYFVESIAQPRGFP 282
            ..:||.||:||||:.: ||| |:|:.:.       |.||  .|.|:|.|::||:..|:..|.||.
Human   238 QKVGHLDFFPNGGKEM-PGC-KKNVLSTITDIDGIWEGIGGFVSCNHLRSFEYYSSSVLNPDGFL 300

  Fly   283 AQRCEPSDMFGICRE------PGGGPAFMGMGADPRIRGK-------FYLDTNDAKPF 327
            ...|...|.|   :|      |..|...||..|| :.:||       |:|:|.::..|
Human   301 GYPCASYDEF---QESKCFPCPAEGCPKMGHYAD-QFKGKTSAVEQTFFLNTGESGNF 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6472NP_611166.2 Pancreat_lipase_like 43..323 CDD:238363 110/312 (35%)
PNLIPRP2NP_005387.3 Lipase 18..354 CDD:395099 110/316 (35%)
Required for galactolipase activity. /evidence=ECO:0000269|PubMed:26494624 93..105 5/13 (38%)
Required for galactolipase activity. /evidence=ECO:0000269|PubMed:26494624 257..279 5/21 (24%)
PLAT_PL 357..469 CDD:238857
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145344
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.