DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6472 and PNLIP

DIOPT Version :9

Sequence 1:NP_611166.2 Gene:CG6472 / 36895 FlyBaseID:FBgn0034166 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_000927.1 Gene:PNLIP / 5406 HGNCID:9155 Length:465 Species:Homo sapiens


Alignment Length:356 Identity:125/356 - (35%)
Similarity:172/356 - (48%) Gaps:58/356 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LAGSPIFYSAAPRGSC----STCCAIKER---------EDI--KFMLYTSRNRNSAQLLHLSDDA 66
            :||..:.|.   |..|    |....|.||         :|:  :|:|||:.|.|:.|.: .:|.:
Human    14 VAGKEVCYE---RLGCFSDDSPWSGITERPLHILPWSPKDVNTRFLLYTNENPNNFQEV-AADSS 74

  Fly    67 RLAQSNFNFNYPLAIYLHGFSESATGERQSSQELKDAFLRRGNYNVILIDWSAMTAVPWYSNAVE 131
            .::.|||..|......:|||.:.  ||......:.....:..:.|.|.:||...:.. .|:.|.:
Human    75 SISGSNFKTNRKTRFIIHGFIDK--GEENWLANVCKNLFKVESVNCICVDWKGGSRT-GYTQASQ 136

  Fly   132 NLPVSGRYLARFLRFLVDK-GYPAKYIHLIGFSLGAEVAGFAGKQLQEWGIKLPRITALDPALPL 195
            |:.:.|..:|.|:.||... ||....:|:||.||||..||.||::...   .:.|||.||||.|.
Human   137 NIRIVGAEVAYFVEFLQSAFGYSPSNVHVIGHSLGAHAAGEAGRRTNG---TIGRITGLDPAEPC 198

  Fly   196 FEGNSSNRRLSPSDARFVDVIHTDGGLL------GNPAPMGHADFYPNGGRPLQPGCAKQNIANN 254
            |:|.....||.||||:|||||||||..:      |....:||.||:||||..: ||| |:||.:.
Human   199 FQGTPELVRLDPSDAKFVDVIHTDGAPIVPNLGFGMSQVVGHLDFFPNGGVEM-PGC-KKNILSQ 261

  Fly   255 -------WLGI--IVGCSHQRAWEYFVESIAQPRGFPAQRCEPSDMFGI-----CREPGGGPAFM 305
                   |.|.  ...|:|.|:::|:.:||..|.||....|...::|..     |  |.||...|
Human   262 IVDIDGIWEGTRDFAACNHLRSYKYYTDSIVNPDGFAGFPCASYNVFTANKCFPC--PSGGCPQM 324

  Fly   306 GMGADPRIRG-------KFYLDTNDAKPFGR 329
            |..|| |..|       ||||||.||..|.|
Human   325 GHYAD-RYPGKTNDVGQKFYLDTGDASNFAR 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6472NP_611166.2 Pancreat_lipase_like 43..323 CDD:238363 112/309 (36%)
PNLIPNP_000927.1 Lipase 17..352 CDD:278576 121/349 (35%)
PLAT_PL 355..465 CDD:238857 125/356 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145348
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.