DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6472 and PLA1A

DIOPT Version :9

Sequence 1:NP_611166.2 Gene:CG6472 / 36895 FlyBaseID:FBgn0034166 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_056984.1 Gene:PLA1A / 51365 HGNCID:17661 Length:456 Species:Homo sapiens


Alignment Length:341 Identity:109/341 - (31%)
Similarity:148/341 - (43%) Gaps:50/341 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 FLLAGSPIFYSAAPRGSCS--TCCAIKEREDIK--FMLYTSRNRNSAQLLHLSDDARLAQSNFNF 75
            :|..||.......|:..|:  ....:.|..|:|  |:|:...|.:..||:..|.|  |..|.||.
Human    18 WLSVGSSGDAPPTPQPKCADFQSANLFEGTDLKVQFLLFVPSNPSCGQLVEGSSD--LQNSGFNA 80

  Fly    76 NYPLAIYLHGFSESATGERQSSQELKDAF----LRRGNYNVILIDW-SAMTAVPWYSNAVENLPV 135
            .....:.:|||....|     .....|.|    ||..|.|||.:|| ...|.|  |.:||:|:..
Human    81 TLGTKLIIHGFRVLGT-----KPSWIDTFIRTLLRATNANVIAVDWIYGSTGV--YFSAVKNVIK 138

  Fly   136 SGRYLARFLRFLVDKGYPAKYIHLIGFSLGAEVAGFAGKQLQEWGIKLPRITALDPALPLFEGNS 200
            ....::.||..|:..|.....||:||.||||.|.|..|   |.:|.:|.:||.||||.|.:...|
Human   139 LSLEISLFLNKLLVLGVSESSIHIIGVSLGAHVGGMVG---QLFGGQLGQITGLDPAGPEYTRAS 200

  Fly   201 SNRRLSPSDARFVDVIHTDGGLLGNPAPMGHADFYPNGGRPLQPGCAKQNIANNWLGIIVGCSHQ 265
            ...||...||.||:.||||...||...|:||.|::.|||:. ||||.....|.....|   |.|.
Human   201 VEERLDAGDALFVEAIHTDTDNLGIRIPVGHVDYFVNGGQD-QPGCPTFFYAGYSYLI---CDHM 261

  Fly   266 RAWEYFVESI-----------AQPRGFPAQRCEPSDMFG----ICREPG----GGPAFMGMGADP 311
            ||...::.::           |..:.|.|.||  .|.|.    .|...|    ||.....:..:.
Human   262 RAVHLYISALENSCPLMAFPCASYKAFLAGRC--LDCFNPFLLSCPRIGLVEQGGVKIEPLPKEV 324

  Fly   312 RIRGKFYLDTNDAKPF 327
            ::    ||.|..:.|:
Human   325 KV----YLLTTSSAPY 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6472NP_611166.2 Pancreat_lipase_like 43..323 CDD:238363 102/305 (33%)
PLA1ANP_056984.1 Lipase 16..336 CDD:278576 108/339 (32%)
Pancreat_lipase_like 49..332 CDD:238363 101/304 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145186
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.