DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6472 and CG6271

DIOPT Version :10

Sequence 1:NP_611166.2 Gene:CG6472 / 36895 FlyBaseID:FBgn0034166 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_651526.1 Gene:CG6271 / 43252 FlyBaseID:FBgn0039476 Length:341 Species:Drosophila melanogaster


Alignment Length:39 Identity:11/39 - (28%)
Similarity:17/39 - (43%) Gaps:5/39 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   221 DHC--GYHLPFLSSPESHDYHHLKFNQCFGLYG--WMDW 255
            |:|  |||...|.......||.:: ...:|.:.  |:.|
  Fly   152 DYCRGGYHPVKLGDLFLQRYHVIR-KLGWGHFSTVWLSW 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6472NP_611166.2 Pancreat_lipase_like 43..323 CDD:238363 11/39 (28%)
CG6271NP_651526.1 Pancreat_lipase_like 68..333 CDD:238363 11/39 (28%)

Return to query results.
Submit another query.