DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6472 and CG6277

DIOPT Version :9

Sequence 1:NP_611166.2 Gene:CG6472 / 36895 FlyBaseID:FBgn0034166 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_651525.1 Gene:CG6277 / 43251 FlyBaseID:FBgn0039475 Length:341 Species:Drosophila melanogaster


Alignment Length:289 Identity:102/289 - (35%)
Similarity:161/289 - (55%) Gaps:22/289 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 IKFMLYTSRNRNSAQLLHLSDDARLAQSNFNFNYPLAIYLHGFSESATGERQSSQELKDAFLRRG 108
            :||.||||.|....:.:..|..: :..|:||..:|....:||:::|.|.  ..:::::.|:|.||
  Fly    68 VKFYLYTSSNPTKGKKITASTKS-IDASSFNSAHPTRFVIHGWTQSYTA--SMNKDIRSAWLSRG 129

  Fly   109 NYNVILIDWSAMTAVPWYSNAVENLPVSGRYLARFLRFLVDK-GYPAKYIHLIGFSLGAEVAGFA 172
            :||||::||:...:|. |:.:|..:..:|:.:|:.:.||.|. |.....:::||.||||.|||:|
  Fly   130 DYNVIVVDWARARSVD-YATSVLAVAATGKKVAKMINFLKDNHGLNLNDLYVIGHSLGAHVAGYA 193

  Fly   173 GKQLQEWGIKLPRITALDPALPLFEGNSSNRRLSPSDARFVDVIHTDGGLLGNPAPMGHADFYPN 237
            ||....   ::..|..||||||||..|..|:||:..||.:|:.|.|:||.||...|:|...||||
  Fly   194 GKNTDG---QVHTIIGLDPALPLFSYNKPNKRLNSDDAWYVESIQTNGGTLGFLKPIGKGAFYPN 255

  Fly   238 GGRPLQPGCAKQNIANNWLGIIVGCSHQRAWEYFVESIAQPRGFPAQRCEPSDMFGICREPGGGP 302
            ||: .||||.        |.:...|||.|:..|:.|::::. .|...:|...:. .:.:|.|...
  Fly   256 GGK-TQPGCG--------LDLTGACSHGRSTTYYAEAVSED-NFGTMKCGDYEE-AVSKECGSTY 309

  Fly   303 AFMGMGADPR---IRGKFYLDTNDAKPFG 328
            :.:.||||..   :.|.:|:..|...|||
  Fly   310 SSVRMGADTNAYMVEGDYYVPVNSKAPFG 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6472NP_611166.2 Pancreat_lipase_like 43..323 CDD:238363 98/282 (35%)
CG6277NP_651525.1 Pancreat_lipase_like 68..333 CDD:238363 98/282 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446043
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000679
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.