DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6472 and CG17192

DIOPT Version :9

Sequence 1:NP_611166.2 Gene:CG6472 / 36895 FlyBaseID:FBgn0034166 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_651522.1 Gene:CG17192 / 43248 FlyBaseID:FBgn0039472 Length:337 Species:Drosophila melanogaster


Alignment Length:291 Identity:91/291 - (31%)
Similarity:157/291 - (53%) Gaps:21/291 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 DIKFMLYTSRNRNSAQLLHLSDDARLAQSNFNFNYPLAIYLHGFSESATGERQSSQELKDAFLRR 107
            ::.|.|||.:|....|.: .:|.:.:..|:||.::.....:||:....|.  ..:.::..|:|.:
  Fly    62 EVSFYLYTKQNPTEGQEI-TADASSIVASHFNKDHGTRFVIHGWKGKYTD--SMNVDITKAWLSK 123

  Fly   108 GNYNVILIDWSAMTAVPWYSNAVENLPVSGRYLARFLRFLVDK-GYPAKYIHLIGFSLGAEVAGF 171
            |::|||:::|:...:|. |:.:|..:|.:|..:...::::.:. ....:.:.:||.||||.|||:
  Fly   124 GDFNVIVVNWARSQSVD-YAMSVRAVPGAGTKVGEMIQYMHENHDMSLETLEVIGHSLGAHVAGY 187

  Fly   172 AGKQLQEWGIKLPRITALDPALPLFEGNSSNRRLSPSDARFVDVIHTDGGLLGNPAPMGHADFYP 236
            ||||:.:  .::..|..||||||||..::.::|||..||.:|:.|.|:||:.|...|:|.|.||.
  Fly   188 AGKQVGQ--KRVHTIVGLDPALPLFSYDNPDKRLSSEDAFYVESIQTNGGVKGFVKPIGKAAFYV 250

  Fly   237 NGGRPLQPGCAKQNIANNWLGIIVGCSHQRAWEYFVESIAQPRGFPAQRCEPSDMFGICREPGGG 301
            :|||. ||||.        :.:...|||.|:..|:.|:|.: ..|.|.:|:.... .:..|.|..
  Fly   251 SGGRK-QPGCG--------VDLAGTCSHARSVIYYAEAITE-NSFGAIQCQDYQA-ALDNECGSS 304

  Fly   302 PAFMGMGADP---RIRGKFYLDTNDAKPFGR 329
            .:.:.|..|.   .:.|.||:..|...|||:
  Fly   305 FSSVRMAEDTNAYNVEGHFYVPVNSEAPFGQ 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6472NP_611166.2 Pancreat_lipase_like 43..323 CDD:238363 87/283 (31%)
CG17192NP_651522.1 Lipase 55..333 CDD:278576 88/287 (31%)
Pancreat_lipase_like 62..329 CDD:238363 87/283 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446053
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000679
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.